60S ribosomal protein L10 Protein, Drosophila melanogaster, Recombinant (His) is expressed in E. coli.
| 説明 |
60S ribosomal protein L10 Protein, Drosophila melanogaster, Recombinant (His) is expressed in E. coli. |
| Species |
Fruit fly
|
| Expression Host |
E. coli
|
| Tag |
N-6xHis
|
| Accession Number |
O61231
|
| 別名 |
QM protein homolog, Large ribosomal subunit protein uL16, dQM, 60S ribosomal protein L10, RpL10
|
| Amino Acid |
MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEALEAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMSVRSSDRYKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERERYEELRDDNRLEPDGCNVKYRPEHGPIAAWEKAQRDVYA
|
| Construction |
1-218 aa
|
| Protein Purity |
> 85% as determined by SDS-PAGE.
|
| 分子量 |
29.5 kDa (predicted)
|
| Formulation |
Tris-based buffer, 50% glycerol
|
| Reconstitution |
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
|
| Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
| Research Background |
N/A
|
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
