Adiponectin Protein, Feline, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 24.9 kDa and the accession number is A4PB30.
| 説明 |
Adiponectin Protein, Feline, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 24.9 kDa and the accession number is A4PB30. |
| Species |
Feline
|
| Expression Host |
E. coli
|
| Tag |
Tag Free
|
| Accession Number |
A4PB30
|
| 別名 |
apM-1, 30 kDa adipocyte complement-related protein, APM1, ACRP30, Adipocyte, C1q and collagen domain-containing protein, Adipocyte complement-related 30 kDa protein, Adipose most abundant gene transcript 1 protein, ADIPOQ
|
| Amino Acid |
QDSETEGPGVVVPLPKGACTGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGVTGIEGPRGFPGIPGRKGEPGESAYVYRSAFSVGLESRVTVPNVPIRFTKIFYNQQNHYDVTTRKFHCNIPGLYYFSYHITVYLKDVKVSLYKRDKAMLFTYDQYQEKNVDQASGSVLLHLETGDEVWLQVYGDGDYNGLYADNVNDSTFTGFLLYYDTV
|
| Construction |
18-244 aa
|
| Protein Purity |
> 90% as determined by SDS-PAGE.
|
| 分子量 |
24.9 kDa (predicted)
|
| Formulation |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
|
| Reconstitution |
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
|
| Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
