ADTRP Protein, Human, Recombinant (His & Myc) is expressed in in vitro E. coli expression system.
説明 | ADTRP Protein, Human, Recombinant (His & Myc) is expressed in in vitro E. coli expression system. |
Species | Human |
Expression Host | E. coli |
Tag | N-10xHis, C-Myc |
Accession Number | Q96IZ2 |
別名 | Fatty acid esters of hydroxy fatty acids hydrolase ADTRP, FAHFA hydrolase ADTRP, C6orf105, Androgen-dependent TFPI-regulating protein |
Amino Acid | MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK |
Construction | 1-230 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
分子量 | 31.8 kDa (predicted) |
Formulation | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Hydrolyzes bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), but not other major classes of lipids. Show a preference for FAHFAs with branching distal from the carboxylate head group of the lipids. Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro). |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
ADTRP Protein, Human, Recombinant (His & Myc) Fatty acid esters of hydroxy fatty acids hydrolase ADTRP FAHFA hydrolase ADTRP C6orf105 Androgen-dependent TFPI-regulating protein recombinant recombinant-proteins proteins protein