Acts as a chaperone. Alpha-crystallin Protein, Mycobacterium bovis, Recombinant (His) is expressed in Baculovirus insect cells with C-9xHis tag. The predicted molecular weight is 18.1 kDa and the accession number is P0A5B8.
説明 | Acts as a chaperone. Alpha-crystallin Protein, Mycobacterium bovis, Recombinant (His) is expressed in Baculovirus insect cells with C-9xHis tag. The predicted molecular weight is 18.1 kDa and the accession number is P0A5B8. |
Species | Mycobacterium bovis |
Expression Host | Baculovirus Insect Cells |
Tag | C-9xHis |
Accession Number | P0A5B8 |
別名 | 14 kDa antigen, Acr, 16 kDa antigen, HSP 16.3 |
Amino Acid | ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN |
Construction | 2-144 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
分子量 | 18.1 kDa (predicted) |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Acts as a chaperone. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
Alpha-crystallin Protein, Mycobacterium bovis, Recombinant (His) 14 kDa antigen Acr 16 kDa antigen HSP 16.3 recombinant recombinant-proteins proteins protein