Virus attachment protein. ASFV (isolate Tick/South Africa/Pretoriuskop Pr4/1996) p12 Protein (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 12.7 kDa and the accession number is P0C9Y3.
説明 | Virus attachment protein. ASFV (isolate Tick/South Africa/Pretoriuskop Pr4/1996) p12 Protein (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 12.7 kDa and the accession number is P0C9Y3. |
Species | ASFV |
Expression Host | E. coli |
Tag | N-10xHis |
Accession Number | P0C9Y3 |
別名 | Protein p12, Pret-110, Inner membrane protein p12 |
Amino Acid | MALDGSSGGGSNVETLLIVAIIVVIMAIMLYYFWWMPRQQKKCSKAEECTCNNGSCSLKTS |
Construction | 1-61 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
分子量 | 12.7 kDa (predicted) |
Formulation | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Virus attachment protein. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
ASFV (isolate Tick/South Africa/Pretoriuskop Pr4/1996) p12 Protein (His) Protein p12 Pret-110 Inner membrane protein p12 recombinant recombinant-proteins proteins protein