Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins.
| 説明 |
Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins. |
| Species |
E. coli
|
| Expression Host |
P. pastoris (Yeast)
|
| Tag |
C-6xHis
|
| Accession Number |
P28585
|
| 別名 |
Beta-lactamase MEN-1, Cefotaximase 1, bla, men1, Beta-lactamase CTX-M-1
|
| Amino Acid |
QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL
|
| Construction |
29-291 aa
|
| Protein Purity |
> 85% as determined by SDS-PAGE.
|
| 分子量 |
30.2 kDa (predicted)
|
| Formulation |
Tris-based buffer, 50% glycerol
|
| Reconstitution |
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
|
| Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
| Research Background |
Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins.
|
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
