Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals. Beta-mammal toxin Cn2 Protein, Centruroides noxius, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 9.6 kDa and the accession number is P01495.
| 説明 |
Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals. Beta-mammal toxin Cn2 Protein, Centruroides noxius, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 9.6 kDa and the accession number is P01495. |
| Species |
Centruroides noxius
|
| Expression Host |
P. pastoris (Yeast)
|
| Tag |
N-6xHis
|
| Accession Number |
P01495
|
| 別名 |
Toxin 2, Beta-mammal toxin Cn2, Toxin II.9.2.2
|
| Amino Acid |
KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS
|
| Construction |
17-82 aa
|
| Protein Purity |
> 90% as determined by SDS-PAGE.
|
| 分子量 |
9.6 kDa (predicted)
|
| Formulation |
Tris-based buffer, 50% glycerol
|
| Reconstitution |
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
|
| Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
| Research Background |
Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals.
|
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
