Potent and specific inhibitor of CaM-kinase II (CAMK2). CAMK2N1 Protein, Human, Recombinant (His & Trx) is expressed in E. coli expression system with N-6xHis-Trx tag. The predicted molecular weight is 25.6 kDa and the accession number is Q7Z7J9.
| 説明 |
Potent and specific inhibitor of CaM-kinase II (CAMK2). CAMK2N1 Protein, Human, Recombinant (His & Trx) is expressed in E. coli expression system with N-6xHis-Trx tag. The predicted molecular weight is 25.6 kDa and the accession number is Q7Z7J9. |
| Species |
Human
|
| Expression Host |
E. coli
|
| Tag |
N-6xHis-Trx
|
| Accession Number |
Q7Z7J9
|
| 別名 |
Calcium/calmodulin-dependent protein kinase II inhibitor 1, CaMKII inhibitory protein alpha, CaMKIIN-alpha, CAMK2N1
|
| Amino Acid |
MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV
|
| Construction |
1-78 aa
|
| Protein Purity |
> 85% as determined by SDS-PAGE.
|
| 分子量 |
25.6 kDa (predicted)
|
| Formulation |
Tris-based buffer, 50% glycerol
|
| Reconstitution |
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
|
| Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
| Research Background |
Potent and specific inhibitor of CaM-kinase II (CAMK2).
|
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
