Candidapepsin-2 Protein, Candida albicans (strain WO-1), Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 42.3 kDa and the accession number is C4YMJ3.
| 説明 |
Candidapepsin-2 Protein, Candida albicans (strain WO-1), Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 42.3 kDa and the accession number is C4YMJ3. |
| Species |
Candida albicans
|
| Expression Host |
E. coli
|
| Tag |
N-6xHis
|
| Accession Number |
C4YMJ3
|
| 別名 |
Aspartate protease 2, ACP 2, Secreted aspartic protease 2, Candidapepsin-2, PRA11, PRA2, SAP2
|
| Amino Acid |
QAVPVTLHNEQVTYAADITVGSNNQKLNVIVDTGSSDLWVPDVNVDCQVTYSDQTADFCKQKGTYDPSGSSASQDLNTPFKIGYGDGSSSQGTLYKDTVGFGGVSIKNQVLADVDSTSIDQGILGVGYKTNEAGGSYDNVPVTLKKQGVIAKNAYSLYLNSPDAATGQIIFGGVDNAKYSGSLIALPVTSDRELRISLGSVEVSGKTINTDNVDVLLDSGTTITYLQQDLADQIIKAFNGKLTQDSNGNSFYEVDCNLSGDVVFNFSKNAKISVPASEFAASLQGDDGQPYDKCQLLFDVNDANILGDNFLRSAYIVYDLDNNEISLAQVKYTSASSISALT
|
| Construction |
57-398 aa
|
| Protein Purity |
> 85% as determined by SDS-PAGE.
|
| 分子量 |
42.3 kDa (predicted)
|
| Formulation |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
|
| Reconstitution |
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
|
| Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
