Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2. CD300LB Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 18.8 kDa and the accession number is A8K4G0.
| 説明 |
Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2. CD300LB Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 18.8 kDa and the accession number is A8K4G0. |
| Species |
Human
|
| Expression Host |
E. coli
|
| Tag |
N-10xHis
|
| Accession Number |
A8K4G0
|
| 別名 |
CMRF35-like molecule 7, CD300LB, CMRF35A2, CD300b, TREM-5, Leukocyte mono-Ig-like receptor 5, IREM-3, Triggering receptor expressed on myeloid cells 5, CLM-7, CLM7, TREM5, LMIR5, Immune receptor expressed on myeloid cells 3, IREM3, CD300 antigen-like family member B, CMRF35-A2
|
| Amino Acid |
IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY
|
| Construction |
18-151 aa
|
| Protein Purity |
> 85% as determined by SDS-PAGE.
|
| 分子量 |
18.8 kDa (predicted)
|
| Formulation |
Tris-based buffer, 50% glycerol
|
| Reconstitution |
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
|
| Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
| Research Background |
Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2.
|
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
