CD3G Protein, Cynomolgus, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.5 kDa and the accession number is Q95LI7.
| 説明 |
CD3G Protein, Cynomolgus, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.5 kDa and the accession number is Q95LI7. |
| Species |
Cynomolgus
|
| Expression Host |
P. pastoris (Yeast)
|
| Tag |
N-6xHis
|
| Accession Number |
Q95LI7
|
| 別名 |
T-cell receptor T3 gamma chain, T-cell surface glycoprotein CD3 gamma chain, CD3G
|
| Amino Acid |
QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT
|
| Construction |
23-113 aa
|
| Protein Purity |
> 90% as determined by SDS-PAGE.
|
| 分子量 |
12.5 kDa (predicted)
|
| Formulation |
Tris-based buffer, 50% glycerol
|
| Reconstitution |
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
|
| Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
| Research Background |
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition to this role of signal transduction in T-cell activation, CD3G plays an essential role in the dynamic regulation of TCR expression at the cell surface. Indeed, constitutive TCR cycling is dependent on the di-leucine-based (diL) receptor-sorting motif present in CD3G.
|
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
