Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.
説明 | Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins. |
Species | Borrelia burgdorferi |
Expression Host | E. coli |
Tag | N-10xHis, C-Myc |
Accession Number | O51698 |
別名 | clpP-2, Endopeptidase Clp 2, ATP-dependent Clp protease proteolytic subunit 2, clpP2 |
Amino Acid | MTGKEDNDACVLHDKSLKLVLKSRSIVIAGEITKDVSRLFQEKILLLEALDFKKPIFVYIDSEGGDIDAGFAIFNMIRFVKPKVFTVGVGLVASAAALIFLAAKLENRFSLPFARYLLHQPLSGFKGVATDIEIYTNELNKVKKELNNIISKETGQKISKIEKDTDRDFWLDSSAAKKYGLVFEVVETKYQLEEFISA |
Construction | 1-198 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
分子量 | 27.2 kDa (predicted) |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
CLPP2 Protein, Borrelia burgdorferi, Recombinant (His & Myc) clpP-2 Endopeptidase Clp 2 ATP-dependent Clp protease proteolytic subunit 2 clpP2 recombinant recombinant-proteins proteins protein