A DNA-binding protein implicated in transcriptional repression and chromosome organization and compaction. Binds nucleation sites in AT-rich DNA and bridges them, forming higher-order nucleoprotein complexes and condensing the chromosome. As many horizontally transferred genes are AT-rich, it plays a central role in silencing foreign genes. A subset of genes are repressed by H-NS in association with other proteins. DNA-binding protein H-NS Protein, SerRatia marcescens, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 19.5 kDa and the accession number is P18955.
| 説明 |
A DNA-binding protein implicated in transcriptional repression and chromosome organization and compaction. Binds nucleation sites in AT-rich DNA and bridges them, forming higher-order nucleoprotein complexes and condensing the chromosome. As many horizontally transferred genes are AT-rich, it plays a central role in silencing foreign genes. A subset of genes are repressed by H-NS in association with other proteins. DNA-binding protein H-NS Protein, SerRatia marcescens, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 19.5 kDa and the accession number is P18955. |
| Species |
Serratia marcescens
|
| Expression Host |
E. coli
|
| Tag |
N-6xHis
|
| Accession Number |
P18955
|
| 別名 |
hnsA, hns, Histone-like protein HLP-II, DNA-binding protein H-NS
|
| Amino Acid |
SERLKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEDSQAQAEIEERTRKLQQYREMLIADGIDPNELLQTMAANKAAGKAKRARRPAKYQYKDENGELKTWTGQGRTPAVIKKAIEEQGKSLDDFLL
|
| Construction |
2-135 aa
|
| Protein Purity |
> 90% as determined by SDS-PAGE.
|
| 分子量 |
19.5 kDa (predicted)
|
| Formulation |
Tris-based buffer, 50% glycerol
|
| Reconstitution |
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
|
| Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
| Research Background |
A DNA-binding protein implicated in transcriptional repression and chromosome organization and compaction. Binds nucleation sites in AT-rich DNA and bridges them, forming higher-order nucleoprotein complexes and condensing the chromosome. As many horizontally transferred genes are AT-rich, it plays a central role in silencing foreign genes. A subset of genes are repressed by H-NS in association with other proteins.
|
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
