Cleaves asparagine-linked oligomannose and hybrid, but not complex, oligosaccharides from glycoproteins.
| 説明 |
Cleaves asparagine-linked oligomannose and hybrid, but not complex, oligosaccharides from glycoproteins. |
| Species |
Streptomyces plicatus
|
| Expression Host |
P. pastoris (Yeast)
|
| Tag |
C-6xHis
|
| Accession Number |
P04067
|
| 別名 |
Endoglycosidase H, Endo-beta-N-acetylglucosaminidase H, Endo H
|
| Amino Acid |
APVKQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFDDEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRTP
|
| Construction |
45-313 aa
|
| Protein Purity |
> 90% as determined by SDS-PAGE.
|
| 分子量 |
31.2 kDa (predicted)
|
| Formulation |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
|
| Reconstitution |
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
|
| Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
| Research Background |
Cleaves asparagine-linked oligomannose and hybrid, but not complex, oligosaccharides from glycoproteins.
|
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
