Probably mediates the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. HDT2 Protein, Arabidopsis thaliana, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 34.3 kDa and the accession number is Q56WH4.
| 説明 |
Probably mediates the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. HDT2 Protein, Arabidopsis thaliana, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 34.3 kDa and the accession number is Q56WH4. |
| Species |
Arabidopsis thaliana
|
| Expression Host |
P. pastoris (Yeast)
|
| Tag |
N-6xHis
|
| Accession Number |
Q56WH4
|
| Amino Acid |
MEFWGVAVTPKNATKVTPEEDSLVHISQASLDCTVKSGESVVLSVTVGGAKLVIGTLSQDKFPQISFDLVFDKEFELSHSGTKANVHFIGYKSPNIEQDDFTSSDDEDVPEAVPAPAPTAVTANGNAGAAVVKADTKPKAKPAEVKPAEEKPESDEEDESDDEDESEEDDDSEKGMDVDEDDSDDDEEEDSEDEEEEETPKKPEPINKKRPNESVSKTPVSGKKAKPAAAPASTPQKTEEKKKGGHTATPHPAKKGGKSPVNANQSPKSGGQSSGGNNNKKPFNSGKQFGGSNNKGSNKGKGKGRA
|
| Construction |
1-306 aa
|
| Protein Purity |
> 90% as determined by SDS-PAGE.
|
| 分子量 |
34.3 kDa (predicted)
|
| Formulation |
Tris-based buffer, 50% glycerol
|
| Reconstitution |
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
|
| Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
| Research Background |
Probably mediates the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events.
|
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
