HIV-2 (subtype A, isolate BEN) Protein Vpx (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 17.2 kDa and the accession number is P18099.
| 説明 |
HIV-2 (subtype A, isolate BEN) Protein Vpx (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 17.2 kDa and the accession number is P18099. |
| Species |
HIV-2
|
| Expression Host |
E. coli
|
| Tag |
N-6xHis
|
| Accession Number |
P18099
|
| Amino Acid |
MTDPRERVPPGNSGEETIGEAFEWLERTIEALNREAVNHLPRELIFQVWQRSWRYWHDEQGMSASYTKYRYLCLMQKAIFTHFKRGCTCWGEDMGREGLEDQGPPPPPPPGLV
|
| Construction |
1-113 aa
|
| Protein Purity |
> 90% as determined by SDS-PAGE.
|
| 分子量 |
17.2 kDa (predicted)
|
| Formulation |
Tris-based buffer, 50% glycerol
|
| Reconstitution |
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
|
| Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
| Research Background |
Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription.
|
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
