| 説明 |
KRAS Protein, Human, Recombinant (G12S, GST) is expressed in E. coli expression system with GST tag. The accession number is P01116. |
| Species |
Human
|
| Expression Host |
E. coli
|
| Tag |
GST
|
| Accession Number |
P01116
|
| 別名 |
NS, C-K-RAS, K-RAS2A, KRAS1, K-RAS2B, KRAS2, K-RAS4A, CFC2, RALD, K-RAS, NS3, KI-RAS, Kirsten rat sarcoma viral oncogene homolog, RASK2, K-RAS4B
|
| Amino Acid |
MTEYKLVVVGASGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
|
| Construction |
A DNA sequence encoding the Human KRAS-G12S (uniprot# P01116) (Met1-Lys169) was expressed with a GST tag at the N-terminus
|
| Protein Purity |
>90% as determined by SDS-PAGE.
|
| Formulation |
Supplied as a 0.2 μm filtered solution of 20 mM Hepes (PH=8.0), 150 mM NaCl, 1 mM DTT
|
| Stability & Storage |
It is recommended to store the product under sterile conditions at -20℃ to -80℃. Samples are stable for up to 12 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
| Research Background |
K-Ras belongs to the small GTPase superfamily, Ras family. As other members of the Ras family, K-Ras is a GTPase and is an early player in many signal transduction pathways. It is usually tethered to cell membranes because of the presence of an isoprenyl group on its C-terminus. K-Ras functions as a molecular on/off switch. Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation. Plays a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes (TSGs) in colorectal cancer (CRC) cells in a ZNF304-dependent manner. Besides essential function in normal tissue signaling, the mutation of a K-Ras gene is an essential step in the development of many cancers. Several germline K-Ras mutations have been found to be associated with Noonan syndrome[4] and cardio-facio-cutaneous syndrome. Somatic K-Ras mutations are found at high rates in Leukemias, colon cancer, pancreatic cancer and lung cancer.
|
参考文献
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
