Bordetella pertussis is the causative agent of whooping cough. An essential step in the disease process is the attachment of the bacteria to the ciliated epithelium of the respiratory tract, enabling the organism to resist normal host-clearance mechanisms. It is unclear which bacterial cell surface component are responsible for adherence but the fimbriae of B.pertussis are prime candidates for being involved in this process. Serotype 3 fimbrial subunit Protein, Bordetella pertussis, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 23.2 kDa and the accession number is P17835.
| 説明 |
Bordetella pertussis is the causative agent of whooping cough. An essential step in the disease process is the attachment of the bacteria to the ciliated epithelium of the respiratory tract, enabling the organism to resist normal host-clearance mechanisms. It is unclear which bacterial cell surface component are responsible for adherence but the fimbriae of B.pertussis are prime candidates for being involved in this process. Serotype 3 fimbrial subunit Protein, Bordetella pertussis, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 23.2 kDa and the accession number is P17835. |
| Species |
Bordetella pertussis
|
| Expression Host |
E. coli
|
| Tag |
N-6xHis
|
| Accession Number |
P17835
|
| Amino Acid |
NDGTIVITGSISDQTCVIEEPSTLNHIKVVQLPKISKNALRNDGDTAGATPFDIKLKECPQALGALKLYFEPGITTNYDTGDLIAYKQTYNASGNGNLSTVSSATKAKGVEFRLANLNGQHIRMGTDKTTQAAQTFTGKVTNGSKSYTLRYLASYVKKPKEDVDAAQITSYVGFSVVYP
|
| Construction |
26-204 aa
|
| Protein Purity |
> 85% as determined by SDS-PAGE.
|
| 分子量 |
23.2 kDa (predicted)
|
| Formulation |
Tris-based buffer, 50% glycerol
|
| Reconstitution |
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
|
| Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
| Research Background |
Bordetella pertussis is the causative agent of whooping cough. An essential step in the disease process is the attachment of the bacteria to the ciliated epithelium of the respiratory tract, enabling the organism to resist normal host-clearance mechanisms. It is unclear which bacterial cell surface component are responsible for adherence but the fimbriae of B.pertussis are prime candidates for being involved in this process.
|
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
