Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium. A single mutation (Thr-14-Ile) confers hemolytic activity against rabbit and human blood. Subtilosin-A Protein, Bacillus subtilis, Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 18.8 kDa and the accession number is O07623.
説明 | Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium. A single mutation (Thr-14-Ile) confers hemolytic activity against rabbit and human blood. Subtilosin-A Protein, Bacillus subtilis, Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 18.8 kDa and the accession number is O07623. |
Species | Bacillus subtilis |
Expression Host | E. coli |
Tag | N-6xHis-KSI |
Accession Number | O07623 |
Amino Acid | NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG |
Construction | 9-43 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
分子量 | 18.8 kDa (predicted) |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium. A single mutation (Thr-14-Ile) confers hemolytic activity against rabbit and human blood. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
recombinant recombinant-proteins proteins protein