May activate the peptidyl carrier protein (PCP) domains of fengycin synthase by transferring the 4'-phosphopantetheinyl moiety of coenzyme A (CoA) to a serine residue. 4'-phosphopantetheinyl transferase ffp Protein, Bacillus subtilis, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 31.0 kDa and the accession number is Q9F4F7.
| 説明 |
May activate the peptidyl carrier protein (PCP) domains of fengycin synthase by transferring the 4'-phosphopantetheinyl moiety of coenzyme A (CoA) to a serine residue. 4'-phosphopantetheinyl transferase ffp Protein, Bacillus subtilis, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 31.0 kDa and the accession number is Q9F4F7. |
| Species |
Bacillus subtilis
|
| Expression Host |
E. coli
|
| Tag |
N-10xHis, C-Myc
|
| Accession Number |
Q9F4F7
|
| 別名 |
4'-phosphopantetheinyl transferase ffp, EC:2.7.8.-, Fengycin synthase-activating enzyme, ffp
|
| Amino Acid |
MKIYGIYMDRPLSQEETDRLMSFVSAEKREKCRRFYHKEDAHRTLLGDVLVRSVISEQYQLNKADIRFSAQEYGKPCIPDLPNAHFNISHSGHWVIGAFDSDPIGVDIEKMKPISLGIAERFFSKNEYSDLLSKHKDEQNDYFYHLWSMKESFIKQEGKGLSLPLDSFSVRLHEDGRVSVELPEHHTPCFIKTYEVDPGYKMAVCAARPDFPEDITMISYEALL
|
| Construction |
1-224 aa
|
| Protein Purity |
> 85% as determined by SDS-PAGE.
|
| 分子量 |
31.0 kDa (predicted)
|
| Formulation |
Tris-based buffer, 50% glycerol
|
| Reconstitution |
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
|
| Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
| Research Background |
May activate the peptidyl carrier protein (PCP) domains of fengycin synthase by transferring the 4'-phosphopantetheinyl moiety of coenzyme A (CoA) to a serine residue.
|
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
