Exhibits strong arylesterase activity with beta-naphthyl acetate and phenyl acetate. May play a role in adipocyte differentiation. APMAP Protein, Mouse, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 47.3 kDa and the accession number is Q9D7N9.
| 説明 |
Exhibits strong arylesterase activity with beta-naphthyl acetate and phenyl acetate. May play a role in adipocyte differentiation. APMAP Protein, Mouse, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 47.3 kDa and the accession number is Q9D7N9. |
| Species |
Mouse
|
| Expression Host |
E. coli
|
| Tag |
N-10xHis, C-Myc
|
| Accession Number |
Q9D7N9
|
| 別名 |
Adipocyte plasma membrane-associated protein, Protein DD16, Apmap
|
| Amino Acid |
ESPIDPQSFSFKEPPFMFGVLHPNTKLRQAERLFENQLSGPESIVNIGDVLFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPTCGRPLGIRAGPNGTLFVVDAYKGLFEVNPQKRSVKLLLSSETPIEGKKMSFVNDLTVTRDGRKIYFTDSSSKWQRRDYLLLVMEATDDGRLLEYDTVTKEVKVLLDQLQFPNGVQLSPEEDFVLVAETTMARIRRVYVSGLMKGGADMFVENMPGFPDNIRPSSSGGYWVAAATIRANPGFSMLDFLSDKPFIKRMIFKMFSQETVMKFVPRYSLVLEVSDSGAFRRSLHDPDGQVVTYVSEAHEHDGYLYLGSFRSPFICRLSLQSI
|
| Construction |
61-415 aa
|
| Protein Purity |
> 90% as determined by SDS-PAGE.
|
| 分子量 |
47.3 kDa (predicted)
|
| Formulation |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
|
| Reconstitution |
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
|
| Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
| Research Background |
Exhibits strong arylesterase activity with beta-naphthyl acetate and phenyl acetate. May play a role in adipocyte differentiation.
|
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
