| 説明 |
Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. May participate in the degradation of foreign protein expressed by the baculovirus system. ApNPV Viral cathepsin Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 31.1 kDa and the accession number is Q91CL9. |
| Species |
ApNPV
|
| Expression Host |
E. coli
|
| Tag |
N-10xHis, C-Myc
|
| Accession Number |
Q91CL9
|
| 別名 |
V-cath, Viral cathepsin, Cysteine proteinase (CP), VCATH
|
| Amino Acid |
PLEFDWRRLNKVTSVKNQGMCGACWAFATLGSLESQFAIKHDQLINLSEQQLIDCDFVDVGCDGGLLHTAYEAVMNMGGIQAENDYPYEANNGPCRVNAAKFVVRVKKCYRYVTLFEEKLKDLLRIVGPIPVAIDASDIVGYKRGIIRYCENHGLNHAVLLVGYGVENGIPFWILKNTWGADWGEQGYFRVQQNINACGIKNELPSSAEIY
|
| Construction |
114-324 aa
|
| Protein Purity |
> 90% as determined by SDS-PAGE.
|
| 分子量 |
31.1 kDa (predicted)
|
| Formulation |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
|
| Reconstitution |
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
|
| Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
| Research Background |
Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. May participate in the degradation of foreign protein expressed by the baculovirus system.
|
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
