Essential for the correct processing of both structural polyproteins and for the maturation of viral precursor membranes at the viral factories. ASFV (strain Ba71V) p17 Protein (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 19.2 kDa and the accession number is Q89424.
| 説明 |
Essential for the correct processing of both structural polyproteins and for the maturation of viral precursor membranes at the viral factories. ASFV (strain Ba71V) p17 Protein (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 19.2 kDa and the accession number is Q89424. |
| Species |
ASFV
|
| Expression Host |
E. coli
|
| Tag |
N-10xHis
|
| Accession Number |
Q89424
|
| 別名 |
Ba71V-107, Minor capsid protein p17, D117L
|
| Amino Acid |
MDTETSPLLSHNLSTREGIKQSTQGLLAHTIARYPGTTAILLGILILLVIILIIVAIVYYNRSVDCKSSMPKPPPSYYVQQPEPHHHFPVFFRKRKNSTSLQSHIPSDEQLAELAHS
|
| Construction |
1-117 aa
|
| Protein Purity |
> 85% as determined by SDS-PAGE.
|
| 分子量 |
19.2 kDa (predicted)
|
| Formulation |
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
|
| Reconstitution |
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
|
| Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
| Research Background |
Essential for the correct processing of both structural polyproteins and for the maturation of viral precursor membranes at the viral factories.
|
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
