Part of the tripartite complex that is required for the CDT activity. CdtC, along with CdtA, probably forms a heterodimeric subunit required for the delivery of CdtB. CDTC Protein, E. coli, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 25.7 kDa and the accession number is Q46670.
| 説明 |
Part of the tripartite complex that is required for the CDT activity. CdtC, along with CdtA, probably forms a heterodimeric subunit required for the delivery of CdtB. CDTC Protein, E. coli, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 25.7 kDa and the accession number is Q46670. |
| Species |
E. coli
|
| Expression Host |
E. coli
|
| Tag |
N-10xHis, C-Myc
|
| Accession Number |
Q46670
|
| 別名 |
Cytolethal distending toxin subunit C, CDT C, CDTC
|
| Amino Acid |
CSSSQDSANNQIDELGKENNSLFTFRNIQSGLMIHNGLHQHGRETIGWEIVPVKTPEEALVTDQSGWIMIRTPNTDQCLGTPDGRNLLKMTCNSTAKKTLFSLIPSTTGAVQIKSVLSGLCFLDSKNSGLSFETGKCIADFKKPFEVVPQSHLWMLNPLNTESPII
|
| Construction |
16-181 aa
|
| Protein Purity |
> 90% as determined by SDS-PAGE.
|
| 分子量 |
25.7 kDa (predicted)
|
| Formulation |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
|
| Reconstitution |
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
|
| Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
| Research Background |
Part of the tripartite complex that is required for the CDT activity. CdtC, along with CdtA, probably forms a heterodimeric subunit required for the delivery of CdtB.
|
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
