IL-12B Protein, Mesocricetus auratus, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 39.8 kDa and the accession number is Q8CJE6.
| 説明 |
IL-12B Protein, Mesocricetus auratus, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 39.8 kDa and the accession number is Q8CJE6. |
| Species |
Mesocricetus auratus
|
| Expression Host |
E. coli
|
| Tag |
N-10xHis, C-Myc
|
| Accession Number |
Q8CJE6
|
| Amino Acid |
IWELEKDVYVVEVDWSPDAAGERVVLTCDTSEEDDIIWTSDKNSEAVGSGKTLTIQVKEFSNAGQYTCHKGGKTLSHSRLLLHKKENGIWSTDILKDQKDPKNKTFLKCEAANYSGRFTCWWLTAISTDLKFNVKSSSSSSDSRAVTCGAASLSAEKVTVDRKDYQKYSVACQEDITCPTAEETLPIGLVMEAQHKYKYENYSTGFFIRDIIKPDPPKNLQLKPLRGSQMELSWEYPDSWSTPHSYFSLKFHVQVHRKRERKDESQFVDKTSATIRCSKGAEVRVRAQDHYYNSSWSRWVSVPCS
|
| Construction |
23-327 aa
|
| Protein Purity |
> 85% as determined by SDS-PAGE.
|
| 分子量 |
39.8 kDa (predicted)
|
| Formulation |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
|
| Reconstitution |
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
|
| Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
| Research Background |
Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.; Associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
|
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
