PLA2G15 Protein, Canine, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 46.8 kDa and the accession number is Q6XPZ3.
| 説明 |
PLA2G15 Protein, Canine, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 46.8 kDa and the accession number is Q6XPZ3. |
| Species |
Canine
|
| Expression Host |
Baculovirus Insect Cells
|
| Tag |
N-10xHis, C-Myc
|
| Accession Number |
Q6XPZ3
|
| Amino Acid |
RRPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKRTESYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVDWGYIRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKNKYIQAFVALGAPWGGVAKTLRVLASGDNNRIPVIRPLKIREQQRSAVSTSWLLPYNYTWSPEKIFVHTPTANYTLRDYHQFFQDIGFKDGWLMRQDTEGLVEAMVPPGVPLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLQSALQCQAWRGHQEHQVSLQALPGSEHIEMLANATTLAYLKRVLLGP
|
| Construction |
32-408 aa
|
| Protein Purity |
> 85% as determined by SDS-PAGE.
|
| 分子量 |
46.8 kDa (predicted)
|
| Formulation |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
|
| Reconstitution |
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
|
| Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
|
| Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
|
| Research Background |
Has dual calcium-independent phospholipase and O-acyltransferase activities with a potential role in glycerophospholipid homeostasis and remodeling of acyl groups of lipophilic alcohols present in acidic cellular compartments. Catalyzes hydrolysis of the ester bond of the fatty acyl group attached at sn-1 or sn-2 position of phospholipids (phospholipase A1 or A2 activity) and transfer it to the hydroxyl group at the first carbon of lipophilic alcohols (O-acyltransferase activity). Among preferred fatty acyl donors are phosphatidylcholines, phosphatidylethanolamines, phosphatidylglycerols and phosphatidylserines. Favors sn-2 over sn-1 deacylation of unsaturated fatty acyl groups of phosphatidylcholines and phosphatidylethanolamines. Among preferred fatty acyl acceptors are natural lipophilic alcohols including short-chain ceramide N-acetyl-sphingosine (C2 ceramide), alkylacylglycerols, monoacylglycerols, and acylethanolamides such as anandamide and oleoylethanolamide. Selectively hydrolyzes the sn-1 fatty acyl group of truncated oxidized phospholipids and may play a role in detoxification of reactive oxidized phospholipids during oxidative stress. Required for normal phospholipid degradation in alveolar macrophages with potential implications in pulmonary surfactant clearance. At neutral pH, hydrolyzes the sn-1 fatty acyl group of the lysophosphatidylcholines.
|
Calculator
Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
bottom
