15
31
カタログ番号 | 製品名 | 別名 | ターゲット |
---|---|---|---|
TP1389 | Exendin-3/4 (64-86) | Others | |
Exendin-3/4 (64-86) is a polypeptide. | |||
T8748 | Exendin-4 acetate | Glucagon Receptor | |
Exendin-4 acetate is a 39 amino acid peptide.Exendin-4 acetate is a long-acting GLP-1 receptor agonist(IC50 = 3.22 nM). | |||
T3967 | Exendin-4 | Exenatide,Exenatide Acetate | Glucagon Receptor |
Exendin-4 (Exenatide) is a glucagon-like peptide-1 receptor (GLP-1) agonist (IC50: 3.22 nM). Exenatide is a 39 amino acid peptide. Compared to GLP-1, exenatide has a longer half-life of 2.4 hours. | |||
T8355 | Exenatide | Exendin-4,Extendin-4 | Glucagon Receptor |
Exenatide (Extendin-4) is a glucagon-like protein-1 (GLP-1) receptor agonist. | |||
TP1394 | {Val1}-Exendin-3/4 | ||
{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide. | |||
TP1461 | SDV-Exendin-3/4 | ||
SDV-Exendin-3/4 is a 32-amino acid peptide. | |||
TP1154 | Exendin-4 peptide derivative acetate | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS,Exendin-4 peptide derivative | |
Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative. | |||
TP1366 | Exendin-3/4 (59-86) | ||
Exendin-3/4 (59-86) is a Exendin-4 peptide derivative. | |||
TP1161 | Exendin-4 peptide derivative | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | |
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. | |||
T76290 | Exendin-4 (3-39) | ||
Exendin-4 (3-39) is a truncated peptide variant of Exendin-4, missing the initial two amino acids, and serves as a potent agonist for the Glucagon-like peptide-1 receptor (GLP-1r). This compound, along with Exendin-4, is... | |||
T76291 | Des His1, Glu8 Exendin-4 | ||
Des His1, Glu8 Exendin-4 is a potent antagonist of the glucagon-like peptide-1 receptor (GLP-1-R), enhancing glucose homeostasis through the dual regulation of insulin secretion and glucose production. This compound is e... | |||
T75859 | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | ||
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. | |||
TP2368 | Albenatide | CJC1134,CJC 1134,CJC-1134 | |
Albenatide is a modified analog of exendin 4 conjugated to recombinant human albumin. | |||
T75860 | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | ||
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. | |||
T36760 | KQMEEEAVRLFIEWLKNGGPSSGAPPPS | Others | |
KQMEEEAVRLFIEWLKNGGPSSGAPPPS is a Exendin-4 peptide derivative. Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon rec... |
カタログ番号 | 製品名 | Species | Expression System |
---|---|---|---|
TMPJ-00864 | VEGF165 Protein, Human, Recombinant | Human | HEK293 Cells |
Human Vascular endothelial growth factor (VEGF), also known as VEGF-A and vascular permeability factor (VPF), belongs to the platelet-derived growth factor family of cysteine-knot growth factors. It is a potent activator... | |||
TMPY-04911 | VEGF165 Protein, Human, Recombinant (His & Avi), Biotinylated | Human,Cynomolgus | HEK293 Cells |
VEGF165 Protein, Human, Recombinant (His & Avi), Biotinylated is expressed in HEK293 mammalian cells with His and Avi tag. The predicted molecular weight is 23.1 kDa and the accession number is P15692-4. | |||
TMPK-00823 | VEGF165 Protein, Human, Recombinant (His & Avi) | Human | HEK293 Cells |
Vascular endothelial growth factor (VEGF or VEGF-A), also known as vascular permeability factor (VPF), is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. VEGF165 appears to be the most a... | |||
TMPY-00749 | FGF-2 Protein, Human, Recombinant | Human | E. coli |
FGF-2 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 16.5 kDa and the accession number is P09038-4. | |||
TMPY-04754 | CASK Protein, Human, Recombinant | Human | Baculovirus Insect Cells |
CASK Protein, Human, Recombinant is expressed in Baculovirus insect cells. The predicted molecular weight is 102.1 kDa and the accession number is O14936-4. | |||
TMPY-01822 | PTK9 Protein, Human, Recombinant (His & GST) | Human | E. coli |
PTK9 Protein, Human, Recombinant (His & GST) is expressed in E. coli expression system with His and GST tag. The predicted molecular weight is 57 kDa and the accession number is Q12792-4. | |||
TMPY-02893 | NT5C3A/NT5C3 Protein, Human, Recombinant | Human | E. coli |
NT5C3A (5'-Nucleotidase, Cytosolic IIIA) is a Protein Coding gene. This gene encodes a member of the 5'-nucleotidase family of enzymes that catalyze the dephosphorylation of nucleoside 5'-monophosphates. The encoded prot... | |||
TMPY-04471 | APEG1 Protein, Human, Recombinant (His) | Human | E. coli |
Striated muscle preferentially expressed protein kinase, also known as aortic preferentially expressed protein 1, APEG-1, SPEG and KIAA1297, is a protein that belongs to the protein kinase superfamily and CAMK Ser/Thr pr... | |||
TMPK-00822 | VEGF165 Protein, Human, Recombinant (His & Avi), FITC-Labeled | Human | HEK293 Cells |
Vascular endothelial growth factor (VEGF or VEGF-A), also known as vascular permeability factor (VPF), is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. VEGF165 appears to be the most a... | |||
TMPK-00423 | CD45 Protein, Human, Recombinant (His & Avi) | Human | HEK293 Cells |
PTPRC (also known as CD45),T cells require the protein tyrosine phosphatase CD45 to detect and respond to antigen because it activates the Src family kinase Lck, which phosphorylates the T cell antigen receptor (TCR) com... | |||
TMPY-00380 | ANTXR2 Protein, Human, Recombinant (hFc) | Human | HEK293 Cells |
ANTXR2 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 57.4 kDa and the accession number is P58335-4. | |||
TMPY-05598 | Siglec-2/CD22 Protein, Human, Recombinant (hFc & Avi), Biotinylated | Human | HEK293 Cells |
Siglec-2/CD22 Protein, Human, Recombinant (hFc & Avi), Biotinylated is expressed in HEK293 mammalian cells with hFc and Avi tag. The predicted molecular weight is 103.7 kDa and the accession number is P20273-4. | |||
TMPY-01033 | IL-32 Protein, Human, Recombinant (isoform alpha, His) | Human | HEK293 Cells |
IL-32 is a recently discovered cytokine that induces various proinflammatory cytokines (TNF-alpha, IL-1beta, IL-6) and chemokines in both human and mouse cells through the NF-kappaB and p38 MAPK inflammatory signal pathw... | |||
TMPY-01117 | MRAP Protein, Human, Recombinant (hFc) | Human | HEK293 Cells |
MRAP (Melanocortin 2 Receptor Accessory Protein) is a Protein Coding gene. This gene encodes a melanocortin receptor-interacting protein. It belongs to the MRAP family. MRAP, which contains a single transmembrane domain,... | |||
TMPK-00424 | CD45 Protein, Human, Recombinant (His & Avi), Biotinylated | Human | HEK293 Cells |
PTPRC (also known as CD45),T cells require the protein tyrosine phosphatase CD45 to detect and respond to antigen because it activates the Src family kinase Lck, which phosphorylates the T cell antigen receptor (TCR) com... | |||
TMPJ-00410 | CD45R0 Protein, Human, Recombinant (His) | Human | HEK293 Cells |
CD45R0 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 80-120 KDa and the accession number is P08575-4. | |||
TMPJ-00782 | Amyloid Precursor Protein, Human, Recombinant (hFc) | Human | HEK293 Cells |
Amyloid precursor protein (APP) is a type I membrane protein with several isoforms due to alternative splicing, performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and... | |||
TMPJ-00233 | CD200R1/CRTR2 Protein, Human, Recombinant (His) | Human | HEK293 Cells |
Cell surface glycoprotein CD200 Receptor 1 (CD200R1) is the receptor for the CD200 (OX-2) membrane glycoprotein. CD200R1 contains one C2- type Ig-like domain and one V-type Ig-like domain within its extracellular domain ... | |||
TMPY-01933 | CHI3L2 Protein, Human, Recombinant (His) | Human | HEK293 Cells |
Chondrocyte protein 39 (YKL-39), also known as Chitinase 3-like 2 (CHI3L2), is a secretory protein of articular chondrocytes belonging to the glycosyl hydrolase 18 family. Its highest expression is in chondrocytes, follo... | |||
TMPY-00119 | FLT1 Protein, Human, Recombinant (hFc) | Human | HEK293 Cells |
FLT1 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 61.1 kDa and the accession number is P17948-4. | |||
TMPY-00711 | CD45 Protein, Human, Recombinant (hFc) | Human | HEK293 Cells |
CD45 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 71.1 kDa and the accession number is P08575-4. | |||
TMPY-04565 | SRPK3 Protein, Human, Recombinant (His & GST) | Human | Baculovirus Insect Cells |
Serine / threonine-protein kinase SRPK3, also known as Muscle-specific serine kinase 1, Serine/arginine-rich protein-specific kinase 3, SR-protein-specific kinase 3, Serine / threonine-protein kinase 23, MSSK-1, SRPK3 an... | |||
TMPY-04563 | CASK Protein, Human, Recombinant (His & GST) | Human | Baculovirus Insect Cells |
CASK Protein, Human, Recombinant (His & GST) is expressed in Baculovirus insect cells with His and GST tag. The predicted molecular weight is 130 kDa and the accession number is O14936-4. | |||
TMPY-00225 | CLEC9A Protein, Mouse, Recombinant (hFc) | Mouse | HEK293 Cells |
CLEC9A Protein, Mouse, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 52.1 kDa and the accession number is Q8BRU4-4. | |||
TMPY-01823 | PTK9 Protein, Human, Recombinant | Human | E. coli |
PTK9 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 29 kDa and the accession number is Q12792-4. | |||
TMPJ-01256 | Caspase-10 Protein, Human, Recombinant (His) | Human | E. coli |
Caspase-10 (CASP10) is a 521 amino acid protein member of the Cysteine-Aspartic Acid Protease (Caspase) family. CASP10 contains two DED (Death Effector) domains and is detectable in most tissues. CASP10 cleavage by Granz... | |||
TMPJ-01333 | TEM8/ANTXR1 Protein, Human, Recombinant (His) | Human | HEK293 Cells |
Anthrax Toxin Receptor 1 (ANTXR1) is a single-pass type I membrane protein that belongs to the ATR family. ANTXR1 contains one VWFA domain and binds PA through the VWA domain. ANTXR1 is highly expressed in tumor endothel... | |||
TMPJ-01188 | CORO6 Protein, Human, Recombinant (His) | Human | E. coli |
Coronin 6, a newly identified member of the coronin family, is highly enriched at adult NMJs and regulates AChR clustering via modulating the interaction between receptors and the actin cytoskeletal network. Coronins are... | |||
TMPK-00702 | ANTXR2 Protein, Human, Recombinant (His) | Human | HEK293 Cells |
The Capillary Morphogenesis Gene 2 (CMG2) gene encodes an Anthrax toxin receptor (ANTXR2),ANTXR2/CMG2 was originally identified as a result of up-regulation during capillary morphogenesis of endothelial cells (ECs) cultu... | |||
TMPK-01356 | SIRP alpha V4 Protein, Human, Recombinant (His & Avi) | Human | HEK293 Cells |
Signal regulatory protein α (SIRPα) is a regulatory membrane glycoprotein from SIRP family expressed mainly by myeloid cells and also by stem cells or neurons.SIRPα acts as inhibitory receptor and interacts with a broadl... | |||
TMPK-01362 | SIRP alpha V4 Protein, Human, Recombinant (His & Avi), Biotinylated | Human | HEK293 Cells |
Signal regulatory protein α (SIRPα) is a regulatory membrane glycoprotein from SIRP family expressed mainly by myeloid cells and also by stem cells or neurons.SIRPα acts as inhibitory receptor and interacts with a broadl... |