|
T12079 |
ML604440
|
|
Proteasome
|
|
ML604440 is a cell permeable proteasome β1i (LMP2) subunit inhibitor. |
|
T4031 |
S1p receptor agonist 1
|
S1p-receptor-agonist-1 |
S1P Receptor
,
LPL Receptor
|
|
S1p receptor agonist 1 (S1p-receptor-agonist-1) is an S1P receptor agonist. |
|
T76200 |
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
|
|
|
|
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, a peptide related to angiotensin-converting enzyme 2 (ACE2), is utilized in research to examine ACE2's function [1]. |
|
T35438 |
(5E)-7-Oxozeaenol
|
|
|
|
(5E)-7-Oxozeaenol is a resorcylic acid lactone that has been found in the fungus MSX 63935 and has enzyme inhibitory and anticancer activities.1,2 It inhibits TGF-β-activated kinase 1 (TAK-1; IC50 = 1.3 μM).1 (5E)-7-Oxoz... |
|
T33514 |
MSC 2032964A
|
MSC-2032964A,MSC2032964A |
ASK
|
|
MSC 2032964A is a potent selective ASK1 inhibitor (IC50 = 93 nM) that is oral bioavailable and brain permeable. It inhibited neuroinflammation in mouse EAE models and blocked LPS-induced phosphorylation of ASK1 and p38 i... |
|
T14924 |
Cenerimod
|
ACT-334441 |
S1P Receptor
|
|
Cenerimod (ACT-334441) is an orally active, selective, and potent sphingosine 1-phosphate receptor (S1P1) agonist (EC50: 1 nM).Cenerimod inhibits multiple S1P isoforms and can be used to study murine experimental autoimm... |
|
T3701 |
MCC950
|
CP-456773 |
NOD
|
|
|
|
T7657L |
MOG peptide (35-55) , mouse, rat acetate
|
Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat acetate,MOG peptide (35-55) , mouse, rat acetate (149635-73-4 Free base) |
Others
|
|
Myelin Oligodendrocyte Glycoprotein (MOG) peptide (35-55) , mouse, rat acetate is a MOG peptide (35-55) derivative. MOG peptide (35-55) is a part of myelin oligodendrocyte glycoprotein (MOG) immunogenic peptide and can b... |
|
T81734 |
Myelin Basic Protein (1-11)
|
|
|
|
Myelin Basic Protein (1-11), an encephalitogenic epitope of MBP, facilitates the induction of experimental autoimmune encephalomyelitis (EAE) [1] [2]. |
|
T82424 |
Experimental allergic encephalitogenic peptide (human)
|
|
|
|
Experimental allergic encephalitogenic peptide (human), an EAE peptide, induces encephalomyelitis in guinea pigs [1]. |
|
T68408 |
AMG-1
|
|
|
|
AMG-1 is a specific CRAC channel inhibitor. AMG-1 blocks the function of effector T cells, but not regulatory T cells in vitro and it attenuates the progression and severity of EAE in vivo. |
|
TP1282 |
PLP (139-151)
|
PLP 139-151 |
|
|
PLP (139-151) is amino acid residue residue 139 to 151 of myelin proteolipid protein (PLP). This peptide is used to induce relapsing-remitting (RR)-EAE model. |
|
T63206 |
SR12418
|
|
|
|
SR12418 is a specific REV-ERB synthetic ligand that acts on REV-ERBα (IC50: 68 nM) and REV-ERBβ (IC50: 119 nM) and can be used to study experimental autoimmune encephalomyelitis (EAE) and colitis. |
|
T30529 |
BMS-520
|
|
|
|
BMS-520 is a potent, selective S1P1 agonist that has shown impressive efficacy when administered orally in a rat model of arthritis and in a mouse model of experimental autoimmune encephalomyelitis (EAE) with multiple sc... |
|
T78031 |
MOG peptide (35-55)
|
|
|
|
MOG peptide (35-55), a myelin oligodendrocyte glycoprotein (MOG) fragment spanning amino acids 35 to 55, selectively stimulates CD4+ T cell expansion and induces experimental autoimmune encephalomyelitis (EAE) in animal ... |
|
T82020 |
J5 peptide
|
Myelin basic protein (85-99) antagonist |
|
|
J5 peptide, an MBP inhibitor, competitively inhibits the binding of MBP 85-99 to HLA-DR2, and mitigates PLP 139-151/MBP 85-99-induced experimental autoimmune encephalomyelitis (EAE) in mice. It is utilized in research pe... |
|
T82621 |
D359-0396
|
|
NOD-like Receptor (NLR)
|
|
D359-0396 is an orally active NLRP3 inflammasome inhibitor that mitigates pyroptosis and reduces IL-1β release in macrophages by inhibiting the oligomerization of NLRP3, ASC, and the cleavage of GSDMD. This compound is e... |
|
T69066 |
Forphenicine
|
|
|
|
Forphenicine is a bacterial metabolite that has been found in S. fulvoviridis and an inhibitor of alkaline phosphatase (IC50 = 0.036 µg/ml for the chicken intestine enzyme). It inhibits the growth of HL-60 leukemia cells... |
|
T39110 |
MOG (35-55), human
|
|
|
|
MOG (35-55), human, a constituent of central nervous system myelin, is distinguishable from mMOG (35-55) due to a proline-to-serine substitution at position 42. It possesses immunogenic properties and is partially cross-... |
|
T73336 |
Ketotifen
|
HC 20-511 |
|
|
Ketotifen (HC 20-511) is a second-generation, orally active noncompetitive histamine 1 (H1) receptor antagonist and mast cell stabilizer. It inhibits 6-phosphogluconate dehydrogenase (PGD) in vitro and displays antiviral... |
|
T80682 |
γ-Fibrinogen 377-395 TFA
|
|
|
|
γ-Fibrinogen377-395 TFA is an inhibitory peptide derived from fibrinogen, which also functions as a fibrinogen epitope. It effectively blocks microglial activation and impedes fibrin-Mac-1 interactions in vitro. Addition... |
|
T65390 |
Fluvoxketone
|
|
|
|
Fluvoxketone is trifluoromethyl-substituted aryl ketone compound useful as an intermediate in the synthesis of Fluvoxamine, which is a selective serotonin reuptake inhibitor. In the synthesis of Fluvoxamine, the ketone c... |
|
T80683 |
γ-Fibrinogen 377-395
|
|
|
|
γ-Fibrinogen377-395 is a peptide derived from fibrinogen, functioning both as an inhibitory molecule and an epitope. It inhibits microglial activation, disrupts fibrin-Mac-1 interactions in vitro, and mitigates experimen... |
|
T72017 |
6(5H)-Phenanthridinone
|
|
|
|
6(5H)-Phenanthridinone is an inhibitor of poly(ADP-ribose) polymerase 1 (PARP1) and PARP2. It decreases radiation-induced PARP activity and proliferation of RDM4 murine lymphoma cells. 6(5H)-Phenanthridinone reduces NF-κ... |
|
T83690 |
[Leu144, Arg147]-PLP (139-151) TFA
|
[Leu144, Arg147] Proteolipid Peptide (139-151),H-His-Ser-Leu-Gly-Lys-Leu-Leu-Gly-Arg-Pro-Asp-Lys-Phe-OH |
|
|
[Leu144,Arg147]-PLP (139-151) is a mutated fragment of the myelin proteolipid protein (PLP), featuring substitutions of tryptophan to leucine and histidine to arginine at positions 144 and 147, respectively. Immunizing m... |
|
T36015 |
PDMP (hydrochloride)
|
|
|
|
PDMP is a ceramide analog first prepared in a search for inhibitors of glucosylceramide synthase. PDMP has two adjacent chiral centers (C1 and C2) allowing for the formation of four possible isomers. PDMP contains all fo... |
|
T69600 |
Spermidine-d6
|
|
|
|
Spermidine-d6 is intended for use as an internal standard for the quantification of spermidine by GC- or LC-MS. Spermidine is an endogenous polyamine. It is formed from putrescine by spermidine synthase. Spermidine (25 µ... |
|
T83910 |
S1PL-IN-31
|
Sphingosine-1-Phosphate Lyase Inhibitor 31,S1PL Inhibitor 31,S1P Lyase Inhibitor 31 |
|
|
S1PL-IN-31 is a dual-function chemical compound acting as an inhibitor of sphingosine-1-phosphate (S1P) lyase with an IC50 value of 210 nM and as an antagonist of the Smoothened (Smo) receptor with an IC50 of 440 nM. Dem... |
|
T83688 |
R 715 TFA
|
[Ac-Lys-[D-βNal7,Ile8]des-Arg9]-BK,Ac-Lys-Arg-Pro-Pro-Gly-Phe-Ser-D2Nal-Ile-OH |
|
|
R 715, a bradykinin B1 receptor antagonist, inhibits contractions in isolated human umbilical cords that express bradykinin B1 receptors (pA2 = 8.49). When administered at doses of 200, 400, and 600 µg/kg, R 715 enhances... |
|
T38106 |
JC-171
|
|
|
|
JC-171, a selective inhibitor of the NLRP3 inflammasome, effectively inhibits LPS/ATP-induced interleukin-1β (IL-1β) release from J774A.1 macrophages with an IC50 of 8.45 μM[1]. |
|
T36296 |
BIO5192 hydrate
|
|
|
|
BIO5192 hydrate is a selective and potent integrin α4β1 (VLA-4) inhibitor (Kd<10 pM). BIO5192 hydrate selectively binds to α4β1 (IC50=1.8 nM) over a range of other integrins. BIO5192 hydrate results in a 30-fold increase... |
