2909
337
5
3
カタログ番号 | 製品名 | 別名 | ターゲット |
---|---|---|---|
T13570 | Benzamide Derivative 1 | Others | |
Benzamide Derivative 1 Benzamide derivative with gastrokinetic activity.Benzamide Derivative 1 can be used in the study of gastrointestinal diseases. | |||
T11550 | Helioxanthin derivative 5-4-2 | Helioxanthin 5-4-2 | HBV |
Helioxanthin derivative 5-4-2 (Helioxanthin 5-4-2) is an analogue of helioxanthin that shows anti-HBV activity in vitro and can be used to study HBV. | |||
T13751 | L-Threonine derivative-1 | Others | |
L-Threonine derivative-1 is acetylsalicylic acid-L-threonine ester with potential analgesic activity. | |||
T11421 | Glutaminase-IN-1 | CB839 derivative | transporter |
T38506 | Cis-Clopidogrel-MP derivative | cis-Clopidogrel-MP derivative,Clopidogrel-MP-AM | |
cis-Clopidogrel-MP derivative, also known as Clopidogrel-MP-AM, is a 3’-methoxyacetophenone derivative of Clopidogrel active metabolite. This compound is an orally-active platelet inhibitor specifically targeting the P2Y... | |||
T12717 | Basimglurant | CTEP Derivative,RG7090 | GluR |
Basimglurant (CTEP Derivative) is a potent, selective and orally available modulator of mGlu5 negative allosteric(Kd of 1.1 nM). | |||
TP1154 | Exendin-4 peptide derivative acetate | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS,Exendin-4 peptide derivative | |
Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative. | |||
T39320 | Hemiasterlin derivative-1 | ||
Hemiasterlin Derivative-1, a derivative of hemiasterlin, is utilized in the synthesis of Antibody-Drug Conjugates (ADC). | |||
TP1392 | Exendin derivative 1 | ||
Exendin derivative 1 is a 39 amino acid peptide. | |||
T19296 | DOTA derivative | Others | |
DOTA derivatives are phenoxy derivatives of cyclic Tosamide;Direct nitrification;It is more convenient to add nitro group after removing the protection of lithium aluminium hydride. | |||
T40328 | Betulinic acid derivative-1 | ||
Betulinic acid derivative-1 demonstrates potent inhibition of osteoclast (OC) differentiation, achieving an IC50 value of 1.86 μM. | |||
T13853 | Pyridazinediones-derivative-1 | Others | |
Pyridazinediones-derivative-1 has potential in treating neurodegenerative disorders. | |||
T26397 | 6PGD-IN-S3 | 6PGD Inhibitor S3,S3,Danthron methyl derivative | Dehydrogenase |
6PGD-IN-S3 (6PGD Inhibitor S3) is an inhibitor of 6-phosphogluconate dehydrogenase (6PGD). | |||
T11654 | Indirubin Derivative E804 | Others | |
Indirubin Derivative E804 is an effective inhibitor of IGF1R, which has an IC50 value of 0.65. | |||
T10106 | 3-arylisoquinolinamine derivative | Others | |
T11249L | Dxd | Exatecan derivative for ADC,OQM5SD32BQ,UNII-OQM5SD32BQ | Topoisomerase |
Dxd (OQM5SD32BQ) is a potent inhibitor of DNA topoisomerase I with an IC50 of 0.31 μM. It is used as a conjugated drug of HER2-targeting ADC. | |||
T19534 | Glycerol derivative 1 | Others | |
Glycerol derivative 1 is a Glycerol derivative. | |||
T13662 | Diarylalkane derivative 1 | Others | |
Diarylalkane derivative 1 is used for the research of pancreatitis. | |||
T12333 | OT antagonist 1 demethyl derivative | Others | |
OT antagonist 1 demethyl derivative is the demethyl derivative of OT antagonist 1. OT antagonist 1 is a selective Oxytocin antagonist (Ki of 50 nM. ) | |||
T13593 | Heterocyclyl carbamate derivative 1 | Others | |
Heterocyclyl carbamate derivative 1, a heterocyclyl carbamate derivative, is used for the research of neurological diseases and inflammatory. | |||
T19495 | Oleanolic acid derivative 2 | Others | |
Oleanolic acid derivative 2 is an oleanolic acid derivative. | |||
TP1161 | Exendin-4 peptide derivative | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | |
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. | |||
T19494 | Oleanolic acid derivative 1 | Others | |
Oleanolic acid derivative 1 is an oleanolic acid derivative. | |||
TP1387 | Cyclosporin A-Derivative 2 | ||
Derivative 2 is A novel Derivative of Cyclosporin A.Cyclosporin A is an immunosuppressant that binds to cyclophilin and inhibits calcineurin. | |||
TP1845 | Cyclosporin A-Derivative 1 | ||
Cyclosporin A-Derivative 1 is a crystalline intermediate derived from the opening of cyclosporin A. | |||
TP1524 | AGA-(C8R) HNG17, Humanin derivative | ||
This peptide is a potent humanin (HN) derivative. It completely suppresses neuronal cell death by Alzheimer's disease-relevant insults. | |||
T19170 | Carbazole derivative 1 | 2-Fluoro-7-[(3-pyridinyl)methyl]-9H-carbazole | Others |
Carbazole derivative 1 is used to reduce androgen or oestrogen levels in mammals. | |||
T10016 | Hydrocarbon chain derivative 1 | 6,6'-Oxybis[2,2-dimethyl-1-hexanol] | Others |
Hydrocarbon chain derivative 1 has inhibitory activities against lipid synthesis. | |||
TP1405 | Cyclosporin A-Derivative 1 Free base | ||
Cyclosporin A-Derivative 1 (Free base) is a crystalline intermediate derived from the opening of cyclosporin A. | |||
T72411 | Kobusine derivative-2 | ||
Kobusine derivative-2, a kobusine derivative, exhibits antiproliferative activity against cancer cells, particularly by inducing the arrest of MDA-MB-231 cells in the sub-G1 phase, thus highlighting its potential antican... | |||
T81977 | Kobusine derivative-1 | ||
Kobusine derivative-1, a variant of Kobusine, exhibits antiproliferative effects on cancer cells [1]. | |||
T76220 | Cyclosporin A-Derivative 3 | ||
Cyclosporin A-Derivative 3 is a derivative of Cyclosporin A with calcineurin inhibition [1] . | |||
T34189 | PTZ-256 | phenothiazine derivative,PTZ256 | |
PTZ-256 is a phenothiazine derivative with chemical name: 3-(10H-phenothiazin-10-yl)propane-1-amine. PTZ-256 has molecule weight 256, therefore, we call it as PTZ-256. | |||
TMIH-0155 | Prasugrel Metabolite Derivative-13C-d3 | Mixture of Diastereomers-13C-d3 | |
Prasugrel Metabolite Derivative-13C-d3 is the 13C and deuterated compound of Prasugrel Metabolite Derivative. | |||
TMIH-0156 | Cis-Clopidogrel-MP-13C-d3 Derivative | ||
cis-Clopidogrel-MP-13C-d3 Derivative is the 13C and deuterated compound of cis-Clopidogrel-MP Derivative. | |||
T13610 | Chol-5-en-24-al-3β-ol | Vitamin D3 derivative | Others |
Chol-5-en-24-al-3β-ol is a steroid compound. | |||
T9062 | CA77.1 | Autophagy | |
CA77.1(CA) is a novel chaperon-mediated autophagy (CMA) activator for the treatment of Alzheimer's disease (AD). | |||
T28467 | PSMA617-TCMC TFA | PSMA617-TCMC TFA salt,PSMA617-analog, PSMA617-derivative with TCMC,PSMA-617-TCMC | |
PSMA617-TCMC is a derivative of PSMA-617 with structure modification, in which the caroboxy groups in DOTA ring is replaced by TCMC macrocycle. PSMA-617 is a ligand used to make 177Lu-PSMA-617, which is a radioactive mol... | |||
T9048 | Ecamsule | Others | |
Ecamsule is a benzylidene camphor derivative, many of which are known for their excellent photostability. It can be added to many sunscreens to filter out UVA rays. | |||
T34911 | TPT-172 HCl (R33) | TPT 172,TPT172,TPT-172,thiophene thiourea derivative. R33 | |
TPT-172, also known as R33 (described in Mecozzi et al' s paper), is a thiophene thiourea derivative with molecule weight 172 in free base form. There is no formal name yet, we temporally call this molecule as TPT-172. P... | |||
T11991 | Mefentrifluconazole | P450 , Antifungal | |
Mefentrifluconazole is a potent, selective and orally active fungal CYP51 (Kd= 0.5 nM) inhibitor, but shows less inhibitory activity on human aromatase (IC50=0.92 μM). Mefentrifluconazole is a novel azole derivative and ... | |||
T1481 | Fudosteine | Others | |
Fudosteine is a novel mucoactive agent and a MUC5AC mucin hypersecretion inhibitor. | |||
T8880 | PFM01 | Others | |
PFM01 is an inhibitor of MRE11 endonuclease. PFM01 can regulate double-strand break repair (DSBR) by nonhomologous end-joining (NHEJ) versus homologous recombination (HR). | |||
T8767 | PfDHODH-IN-2 | Dehydrogenase , Parasite | |
PfDHODH-IN-2 is a dihydrothiophenone derivative, is a potent Plasmodium falciparum dihydroorotate dehydrogenase (PfDHODH, IC50 : 1.11 μM) inhibitor . It is used an antimalarial agent and can be used for the research of m... | |||
T7824 | Eberconazole Nitrate | Ebernet | Antifungal |
Eberconazole Nitrate (Ebernet) is an azole antifungal agent and broad-spectrum imidazole derivative. | |||
T3389 | Antitumor agent-21 | TRX818 | Others |
Antitumor agent-21 (TRX818) is an orally bioavailable agent with potential antineoplastic and anti-vasculogenic mimicry (VM) activities. | |||
T6594 | MNS | Syk , Src , p97 | |
MNS is a tyrosine kinases inhibitor, inhibits Syk, Src, p97 with IC50 of 2.5 μM, 29.3 μM and 1.7 μM, respectively. | |||
T9723 | GluR6 antagonist-1 | Src | |
GluR6 antagonist-1 inhibits the pY binding site of tyrosine kinase p56lck SH2 domain. | |||
T19438 | Myristyl nicotinate | Tetradecyl nicotinate | GPR |
Myristyl nicotinate (Tetradecyl nicotinate) is an ester prodrug being developed for delivery of nicotinic acid (NIC) into the skin for prevention of actinic keratosis and its progression to skin cancer. | |||
T20533 | NNK | Nicotine-derived nitrosamine ketone | Lipoxygenase |
NNK (Nicotine-derived nitrosamine ketone) is a procarcinogen and a major tobacco-specific toxicant. It inhibits the expression of lysyl oxidase which is a tumor suppressor. |
カタログ番号 | 製品名 | 別名 | ターゲット |
---|---|---|---|
T82896 | Benzylbenzofuran derivative-1 | ||
Benzylbenzofuran Derivative-1 (Compound 8), a benzylbenzofuran derivative, is isolatable from Silene conoidea [1]. | |||
T8254 | Chrysoobtusin | Others | |
Chrysoobtusin belongs to the class of organic compounds known as hydroxyanthraquinones. | |||
T8087 | Tropolone | Tyrosinase | |
Tropolone, a metal chelator, possesses weak antioxidative and radical-scavenging properties and shows a strong affinity for ferric ion | |||
T9057 | Norbergenin | IL Receptor , TNF , Reactive Oxygen Species | |
Norbergenin is a chemical compound. It is the O-demethylated derivative of bergenin. It can be isolated from rhizomes of Bergenia stracheyi. | |||
TN1546 | Dactylorhin A | NO Synthase | |
Dactylorhin A, a succinate derivative ester isolated from the rhizomes of Gymnadenia conopsea, demonstrates a moderate inhibitory effect on nitric oxide (NO) production in RAW 264.7 macrophage cells. | |||
TN1899 | Lycoramine | AChE | |
Lycoramine is a natural product isolated from Lycoris radiate. Lycoramine is a potent acetylcholinesterase (AChE) inhibitor | |||
TN1149 | 6''-O-acetylsaikosaponin A | Others | |
6''-O-acetylsaikosaponin A is an acetyl saikosaponin isolated from the roots of Bupleurum chinense. Itshows some osteoclast-inhibiting activities | |||
TN7060 | Methyl oleanonate | PPAR | |
3-Oxoolean-12-en-28-oic acid methyl ester is a triterpenoid PPARγ agonist isolated from Pistacia with anticancer properties. | |||
T12045 | (-)-Hydroxycitric acid lactone | Garcinia lactone | ATP Citrate Lyase |
(-)-Hydroxycitric acid lactone (Garcinia lactone) is an anti-obesity agent.(-)-Hydroxycitric acid lactone was a potent inhibitor of ATP citrate lyase, which catalyzes the extramitochondrial cleavage of citrate to oxaloac... | |||
T19720 | Colcemid | C 12669,C-12669,NSC-3096,Kolchicin,C12669,Demecolcine | Microtubule Associated |
Colcemid (NSC-3096) is an inhibitor of microtubule polymerization. It used to study embryonic cloning. | |||
T4116 | S-Adenosyl-DL-Methionine | Ademetionine,S-ADENOSYL-L-METHIONINE | Others |
S-Adenosyl-DL-Methionine (Ademetionine) is a ubiquitous methyl donor involved in a wide variety of biological reactions, including those mediated by DNA and protein methyltransferases. SAM reportedly ameliorates depressi... | |||
T2185 | L-Ascorbic acid 2-phosphate trisodium | L-Ascorbic acid 2-phosphate trisodium salt,Sodium L-ascorbyl-2-phosphate,Sodium ascorbyl phosphate,2-Phospho-L-ascorbic acid trisodium salt,Sodium ascorbyl monophosphate | Reactive Oxygen Species , c-Met/HGFR , Endogenous Metabolite |
L-Ascorbic acid 2-phosphate trisodium (Sodium ascorbyl phosphate) is used in biocatalytic dephosphorylation for electric power generation and electrochemical detection assays. | |||
T2O2770 | Agarotetrol | Others | |
Agarotetrol is a flavonoid derivative isolated from agarwood. | |||
TN7122 | Micromarin F | E-Methylarnottinin,5'-hydroxylosthole | Others |
Micromarin F (E-Methylarnottinin) is a coumarin derivative extracted from the stems of Micromelum minutum Wight et Arn. | |||
T8101 | Nepsilon-Acetyl-L-lysine | Others , Endogenous Metabolite | |
Nepsilon-Acetyl-L-lysine is a derivative of the lysine. | |||
T15138 | DL-Dopa | Endogenous Metabolite | |
DL-Dopa is a phenylalanine beta-hydroxylated derivative. | |||
T5S2350 | Beta-Acetoxyisovalerylshikonin | Acetoxyisovalerylalkannin | Others |
Acetoxyisovalerylshikonin, a naphthoquinone derivative extracted from Arnebia euchroma, is a chemical compound. | |||
TJS0312 | 7-hydroxy-4-methyl-8-nitrocoumarin | Others | |
7-Hydroxy-4-methyl-8-nitrocoumarin is a derivative of coumarin. | |||
TN7123 | Enmein, 13-deoxy-19-hydroxy-, (19R)- | Others | |
Enmein, 13-deoxy-19-hydroxy-, (19R)- is an Enmein-type diterpene derivative and can be used in the preparation of antitumor drugs. | |||
TN5746 | Gnetifolin E | Others | |
Gnetifolin E is a new resveratrol trimer derivative from Gnetum brunonianum. | |||
T2977 | Vanillin acetate | Acetovanillin,Acetylvanillin,4-Formyl-2-methoxyphenyl acetate,4-Acetoxy-3-methoxybenzaldehyde | Others |
Acetylvanillin is a derivative of Vanillin, the primary component found in vanilla bean extract. | |||
T0444 | Econazole | (±)-Econazol | Antibiotic , Antifection , Antifungal |
Econazole ((±)-Econazol) is an imidazole derivative that is commonly used as a topical antifungal agent. | |||
T40370 | 2′-Deoxyadenosine 5′-monophosphate disodium | Endogenous Metabolite | |
2′-Deoxyadenosine 5′-monophosphate disodium, a nucleic acid AMP derivative, is a deoxyribonucleotide present in DNA. It is employed for researching adenosine-based interactions within DNA synthesis and damage analysis. | |||
T0938 | Thiabendazole | 2-(4-Thiazolyl)benzimidazole | Microtubule Associated , Mitochondrial Metabolism , Parasite |
Thiabendazole (2-(4-Thiazolyl)benzimidazole) is a benzimidazole derivative with anthelminthic property. | |||
T1151 | Roxithromycin | Roxl-150,RU-28965 | ribosome , Antibacterial , Antibiotic |
Roxithromycin (RU-28965) is a semi-synthetic derivative of the macrolide antibiotic erythromycin with antibacterial and anti-malarial activities. | |||
T1262 | Tazobactam | Tazobactamum,Tazobactam acid,YTR-830H,CL-298741 | Antibacterial , Antibiotic |
Tazobactam (YTR-830H) is an antibacterial penicillin derivative which inhibits the action of bacterial beta-lactamases. | |||
T10886 | Crocetine dimethyl ester | Dimethylcrocetin | Antioxidant |
Crocetine dimethyl ester (Dimethylcrocetin) is a saffronin derivative with antioxidant activity, inhibition of AChE activity, and inhibition of cell growth and differentiation. | |||
T1079 | Metronidazole | Flagyl,Metronidazol,Anagiardil | Apoptosis , NADPH , Hydrogenase , Antibacterial , Antibiotic , Parasite , Antifection |
Metronidazole (Metronidazol) is a synthetic nitroimidazole derivative with antiprotozoal and antibacterial activities. | |||
T21367 | Tetrahydrofolic acid | 5,6,7,8-tetrahydrofolic acid,folate-H4,Tetrahydropteroylglutamic acid,th-folate | Endogenous Metabolite |
Tetrahydrofolic acid (5,6,7,8-tetrahydrofolic acid) is a vitamin B9 derivative that is a common one-carbon donor in organisms and is involved in growth and metabolism. | |||
TN7066 | Coryneine | 2-(3,4-dihydroxyphenyl)ethyl-trimethylazanium,Quaternary dopamine,Trimethyl(3,4-dihydroxyphenethyl)aminium,Dopamine methiodide | Others |
Coryneine (Trimethyl(3,4-dihydroxyphenethyl)aminium) is a quaternary ammonium derivative of dopamine derived from aconite root. | |||
TN7051 | 2,4-Dihydroxybenzaldehyde | 4-Formylresorcinol,beta-Resorcylaldehyde,4-Hydroxysalicylaldehyde | Endogenous Metabolite |
2,4-Dihydroxybenzaldehyde (4-Formylresorcinol) is a resorcinol derivative with potent antioxidant and antibacterial activity. 2,4-Dihydroxybenzaldehyde is an endogenous metabolite. | |||
T16747 | Riboflavin Tetrabutyrate | Reactive Oxygen Species | |
T8047 | Menthyl acetate | (1R)-(-)-Menthyl acetate,(-)-Menthyl acetate,L-Menthyl acetate | Others |
(1R)-(-)-Menthyl acetate (L-Menthyl acetate) is a derivative of L-menthol. | |||
TN6773 | Acetoxyvalerensre | acetylvalerenolic acid | GABA Receptor |
Acetoxyvalerensre (acetylvalerenolic acid) (acetylvalerenolic acid) is a derivative of valerenic acid, which is a a GABAA receptor modulator. | |||
T6780 | Benzamide | Amid kyseliny benzoove,Phenylcarboxyamide,Benzoylamide | PARP , Endogenous Metabolite |
Benzamide (Amid kyseliny benzoove), an inhibitor of poly(ADP-ribose) polymerase, is a derivative of benzoic acid. | |||
T4109 | Rhapontigenin 3'-O-glucoside | Others | |
Rhapontigenin 3'-O-glucoside, a derivative of Rhapontigenin, functions as a P450 1A1 inhibitor and is utilized in cancer prevention. | |||
T5986 | 3-Hydroxypicolinic acid | Picolinic acid, 3-hydroxy- (6CI,7CI,8CI),2-Carboxy-3-hydroxypyridine | Endogenous Metabolite |
3-Hydroxypicolinic acid (Picolinic acid, 3-hydroxy- (6CI,7CI,8CI)), a picolinic acid derivative, belongs to the pyridine family. | |||
T2807 | Caffeic Acid | Lipoxygenase , Endogenous Metabolite , TRP/TRPV Channel | |
Caffeic Acid is an orally bioavailable, hydroxycinnamic acid derivative and polyphenol, with potential anti-oxidant, anti-inflammatory, and antineoplastic activities. | |||
T2962 | 5α-Cholestan-3β-ol | Dihydrocholesterol,Zymostanol,5α-Cholestanol,5alpha-Cholestanol,NSC 18188,Beta-Cholestanol | Others , Endogenous Metabolite |
5α-Cholestan-3β-ol (NSC 18188) is a cholesterol derivative found in human feces, gallstones, eggs, and other biological matter. | |||
T8021 | Dibenzoyl Thiamine | Bentiamine | Others |
Dibenzoyl Thiamine (Bentiamine), a lipophilic derivative of vitamin B (thiamine), is a kind of food additive | |||
TN3396 | Alpinumisoflavone acetate | 4'-O-Acetylalpinumisoflavone | Others |
Alpinumisoflavone acetate (4'-O-Acetylalpinumisoflavone) is a new alpinumisoflavone derivative. Alpinumisoflavone strongly inhibits germ tube growth at 0.63 ug/disc. | |||
PDK0015 | 4-Hydroxycoumarin | Endogenous Metabolite , Antibacterial , AChR | |
4-Hydroxycoumarin is a coumarin derivative and one of the versatile heterocyclic scaffolds with electrophilic and nucleophilic properties. | |||
T0814 | Ampicillin Trihydrate | NCI-C56086 | Antibacterial , Antibiotic |
Ampicillin Trihydrate (NCI-C56086), a broad-spectrum semisynthetic derivative of aminopenicillin, is a β-lactam antibiotic. | |||
T5S0836 | Isoastragaloside II | Astrasieversianin VII | Others |
Isoastragaloside II (Astrasieversianin VII) is a derivative Astragaloside I, an ingredient in Astragalus membranaceus which is reported to have osteogenic properties. | |||
T2217 | Cephalomannine | Baccatin III | Microtubule Associated |
Cephalomannine (Baccatin III) is a taxol derivative obtained from Taxus yunnanensis with antitumor activity. | |||
TN1643 | Ferulamide | 4-Hydroxy-3-methoxycinnamide | PAFR , AChR |
Ferulamide (4-Hydroxy-3-methoxycinnamide), a Ferulic acid derivative, shows potent inhibitory activity against arachidonic acid-induced platelet aggregation. | |||
TN7048 | 3-O-p-Coumaroylquinic acid | Others | |
3-O-p-Coumaroylquinic acid, hydroxycinnamic acid derivative, is isolated from a 70% methanolic Crataegus extract (Crataegi folium cum flore). | |||
TQ0301 | Kuwanon A | NO Synthase | |
TMS0719 | Sequoyitol | 5-O-Methyl-Myo-Inositol | Others |
Sequoyitol (5-O-Methyl-Myo-Inositol), a methyl derivative of inositol, is often used to treat diabetes. | |||
TN1419 | Rhamnetin | beta-Rhamnocitrin | Others , Phospholipase |
Rhamnetin (beta-Rhamnocitrin), a quercetin derivative found in Coriandrum sativum, has antioxidant and anti-inflammatory activities. Rhamnetin inhibits secretory phospholipase A2. | |||
------------------------ More ------------------------ |
カタログ番号 | 製品名 | Species | Expression System |
---|---|---|---|
TMPH-02461 | PylS Protein, Methanosarcina barkeri, Recombinant (His) | Methanosarcina barkeri | E. coli |
Catalyzes the attachment of pyrrolysine to tRNA(Pyl). Pyrrolysine is a lysine derivative encoded by the termination codon UAG. pylS Protein, Methanosarcina barkeri, Recombinant (His) is expressed in E. coli expression sy... | |||
TMPH-00295 | PAG-2 Protein, Bovine, Recombinant (His) | Bovine | E. coli |
PAG2 or a processed derivative of this molecule might represent a factor that binds the LH receptor. PAG-2 Protein, Bovine, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted mole... | |||
TMPH-02564 | CARNMT1 Protein, Mouse, Recombinant (His & SUMO) | Mouse | E. coli |
N-methyltransferase that catalyzes the formation of anserine (beta-alanyl-N(Pi)-methyl-L-histidine) from carnosine. Anserine, a methylated derivative of carnosine (beta-alanyl-L-histidine), is an abundant constituent of ... | |||
TMPH-01525 | CMAHP Protein, Human, Recombinant (His & Myc) | Human | E. coli |
Sialic acids are components of carbohydrate chains of glycoconjugates and are involved in cell-cell recognition and cell-pathogen interactions. That protein has no CMP-N-acetylneuraminate monooxygenase activity and is no... | |||
TMPY-00585 | Annexin A8 Protein, Human, Recombinant (His) | Human | E. coli |
We have previously shown that Annexin A8 (ANXA8) is strongly associated with the basal-like subgroup of breast cancers, including BRCA1-associated breast cancers, and poor prognosis; while in the mouse mammary gland AnxA... |
カタログ番号 | 製品名 | ||
---|---|---|---|
L6030 | Natural Product Derivatives Library for CADD | 163000 compounds | |
Large quantity: contains 163,000 natural product derivatives and the number is continuously updating; | |||
NY1000 | Natural Product Derivatives Library | 4000 compounds | |
The library consists of more than 4,000 members belonging 22 scaffolds (average 180 compounds per scaffold). | |||
L2800 | Serotonin Receptor-Targeted Compound Library | 268 compounds | |
A unique collection of 268 compounds targeting serotonin receptors for high throughput screening and high content screening; |