検索結果

Search Results for " APP "

阻害剤

天然化合物

リコンビナントタンパク質

ライブラリー

カタログ番号	製品名	別名	ターゲット
T30103	APP-CHMINACA	PX-3,PX3
	APP-CHMINACA is a synthetic cannabinoid (CB) featuring a 1-(cyclohexylmethyl)-1H-indazole-3-carboxamide (CHMINACA) base. It displays a 10-fold greater affinity for the central CB1 receptor than that of JWH 018.
T21890	JLK6		Gamma-secretase
	JLK6 was a gamma-secretase inhibitor that does not interfere with Notch signalling		Gamma-secretase
T9713	δ-secretase inhibitor 11		Beta Amyloid , Caspase
	δ-secretase inhibitor 11 is an inhibitor of δ-secretase and can be used as a lead compound for translational development of AD treatment.		Beta Amyloid , Caspase
TP1798	Pep-1 (uncapped)	Pep-1 uncapped	Others
	Pep-1 (uncapped), which has 21 amino acid residues, is a known carrier peptide that delivers full-length native proteins in vitro and in vivo.		Others
T78339	Human IgG4 (S228P) kappa, Isotype Control
	Human IgG4 (S228P) kappa Isotype Control is a human-mouse chimeric monoclonal antibody serving as an isotype control specifically for the human IgG4 (S228P)κ antibody.
T38570	DMAPP triammonium	Dimethylallyl diphosphate triammonium,Dimethylallyl Pyrophosphate triammonium salt	Others
	DMAPP triammonium (Dimethylallyl diphosphate triammonium) is one of the prerequisite substances for an isoprenoid involved in the mevalonate (MVA) pathway, which can be used in the study of metabolism-related diseases.		Others
T78337	Mouse IgG2a kappa, Isotype Control
	Mouse IgG2a kappa, Isotype Control is an isotype antibody to murine-derived IIgG2a kappa antibody.
T28818	SMAPP1
	SMAPP1 is an activator of protein phosphatase 1 (PP1). SMAPP1 induces PP1 activity in vitro and activates latent HIV-1 provirus in cultured and primary T cells.
T69053	ANAPP3
	ANAPP3 is a P2x-purinoceptor antagonist. It affects contractions in various muscle groups and tissues.
T78338	Rat IgG1 kappa, Isotype Control
	Rat IgG1 kappa Isotype Control is a rat monoclonal antibody serving as an isotype control specific for Rat IgG1κ antibody.
T81317	Rabbit IgG1 kappa, Isotype Control
	Rabbit IgG1 kappa Isotype Control is a rabbit monoclonal antibody serving as an isotype control for Rabbit IgG1κ antibody.
T81760	Mouse IgG1 (D265A) kappa, Isotype Control
	Mouse IgG1 (D265A) kappa Isotype Control is a monoclonal antibody that serves as an isotype control for Mouse IgG1 (D265A) κ antibody.
T22069	D-NMAPPD
	D-NMAPPD ((1R,2R)-B13) is an acid ceramidase inhibitor. D-NMAPPD regulates the properties of NMDA receptor by enhancing the endogenous production of ceramides. D-NMAPPD has anticancer effecs [1] [2].
T126391	Sappanol
	Sappanol is a useful organic compound for research related to life sciences and the catalog number is T126391.
T82158	Human IgG1 (S239D/I332E) kappa, Isotype Control
	Human IgG1 (S239D/I332E) kappa Isotype Control is a chimeric monoclonal antibody derived from human and mouse sequences, serving as an isotype control for the Human IgG1 (S239D/I332E)κ antibody.
T82156	Human IgG3 kappa, Isotype Control
	Human IgG3 kappa Isotype Control is a chimeric monoclonal antibody comprising human and mouse components, serving as an isotype control for human IgG3κ antibodies.
T126471	3'-Deoxy-4-O-methylepisappanol
	3'-Deoxy-4-O-methylepisappanol is a useful organic compound for research related to life sciences and the catalog number is T126471.
T36760	KQMEEEAVRLFIEWLKNGGPSSGAPPPS
	KQMEEEAVRLFIEWLKNGGPSSGAPPPS is a Exendin-4 peptide derivative. Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon rec...
T73416	BiCAPPA
	BiCAPPA, a pioneering bivalent antiprion ligand, effectively reduces the infectious conformational form of prion protein (PrP Sc) in scrapie-infected cells, achieving this at a concentration (EC 50) of 0.32 μM.
T76028	Amylin (IAPP), feline TFA
	Amylin (IAPP), feline TFA, a 37-amino acid polypeptide derived from felines, stands as a principal secretion product of the pancreatic islets' β-cells. This regulatory peptide notably inhibits the secretion of insulin an...
T75860	GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
	GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
TP1519	Amylin (IAPP), feline
	Amylin (IAPP), feline is the peptide subunit of amyloid found in pancreatic islets of type 2 diabetic patients and in insulinomas.
T78244	Human IgG4 kappa, Isotype Control
	Human IgG4 kappa Isotype Control is a monoclonal antibody serving as an isotype control for the human IgG4κ antibody [1].
T81756	Mouse IgG3 kappa, Isotype Control
	Mouse IgG3 kappa Isotype Control is a monoclonal antibody serving as an isotype control specifically for mouse IgG3κ antibodies.
T78242	Human IgG1 kappa, Isotype Control
	Human IgG1 kappa Isotype Control is a human monoclonal antibody serving as an isotype control specifically for human IgG1κ antibodies [1].
T78340	Human IgG1 (N297A) kappa, Isotype Control
	Human IgG1 (N297A) kappa Isotype Control is a human-mouse chimeric monoclonal antibody serving as an isotype control specifically for the human IgG1 (N297A)κ antibody.
T81757	Mouse IgG2c kappa, Isotype Control
	Mouse IgG2c kappa Isotype Control is a monoclonal antibody serving as a specificity control for mouse IgG2cκ antibody assays.
T82161	Human IgG1 (D265A) kappa, Isotype Control
	Human IgG1 (D265A) kappa Isotype Control is a chimeric monoclonal antibody derived from both human and mouse, designed to serve as an isotype control for the human IgG1 (D265A)κ antibody.
T81758	Mouse IgG2b kappa, Isotype Control
	Mouse IgG2b kappa Isotype Control is a mouse monoclonal antibody serving as an isotype control for mouse IgG2bκ antibody applications.
T2806L	Lappaconitine HCl	Lappaconitine hydrochloride
	Lappaconitine HCl is a centrally acting non-opioid analgesic and class-I antiarrhythmic. It acts by binding to the site-2 receptor and irreversibly blocking hH1 sodium channels.
T22856	IgG light chain variable region [Homo sapiens]/IgM/kappa antibody [Mus musculus]		Others
	IgG has four forms, provides the majority of antibody-based immunity against invading pathogens. The only antibody capable of crossing the placenta to give passive immunity to the fetus. Eliminates pathogens in the early...		Others
T66146	(SP-4-4)-2-[2-(Amino-KappaN)ethyl]phenyl-KappaC]chloro[dicyclohexyl[2',4',6'-tris(1-methylethyl)[1,1'-biphenyl]-2-yl]phosphine]-Palladium
	(SP-4-4)-2-[2-(Amino-KappaN)ethyl]phenyl-KappaC]chloro[dicyclohexyl[2',4',6'-tris(1-methylethyl)[1,1'-biphenyl]-2-yl]phosphine]-Palladium is a useful organic compound for research related to life sciences. The catalog nu...
T82160	Human IgG1 (D270N) kappa, Isotype Control
	Human IgG1 (D270N) kappa Isotype Control is a chimeric human-mouse monoclonal antibody that serves as an isotype control for the human IgG1 (D270N)κ antibody.
T125353	Apparicine
	Apparicine is a useful organic compound for research related to life sciences and the catalog number is T125353.
T78243	Human IgG2 kappa, Isotype Control
	Human IgG2 kappa Isotype Control is a monoclonal antibody serving as an isotype control specific to human IgG2κ antibodies [1].
T78612	APPA		Apoptosis
	APPA, an aldose reductase inhibitor, demonstrates efficacy in preventing apoptosis and symptoms of Streptozotocin-induced diabetes in rats through inhibition of the polyol pathway. This compound shows promise for researc...		Apoptosis
T75859	FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
	FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
T13663	Ds-HAPP		Others
	Ds-HAPP is an anthrancenyl and dansyl fluorophore ligand.		Others
T81759	Mouse IgG1 (N297A) kappa, Isotype Control
	Mouse IgG1 kappa (N297A) Isotype Control is a mouse monoclonal antibody serving as an isotype control specifically for Mouse IgG1(N297A)κ antibodies.
T81755	Mouse lgG2a (D265A) kappa, Isotype Control
	Mouse IgG2a (D265A) kappa Isotype Control is a monoclonal antibody serving as an isotype control specifically for the Mouse IgG2a (D265A) antibody.
T78341	Human IgG1 (F405L) kappa, Isotype Control
	Human IgG1 (F405L) kappa Isotype Control is a chimeric human-mouse monoclonal antibody serving as an isotype control for the human IgG1 (F405L)κ antibody.
T37056	D-erythro-MAPP
	D-erythro-MAPP is a derivative of ceramide and an inhibitor of alkaline ceramidase (Ki = 2-13 μM; IC50 = 1-5 μM). It is selective for alkaline ceramidase over acid ceramidase (IC50 = >500 μM) as well as the serine/threon...
T126375	4-O-Methylepisappanol
	4-O-Methylepisappanol is a useful organic compound for research related to life sciences and the catalog number is T126375.
T126481	Sappanone B
	Sappanone B is a useful organic compound for research related to life sciences and the catalog number is T126481.
T125730	Glucocapparin
	Glucocapparin is a useful organic compound for research related to life sciences and the catalog number is T125730.
T38039	(E)-C-HDMAPP (ammonium salt)
	Synthetic and natural alkyl phosphates, also known as phosphoantigens, stimulate the proliferation of γδ-T lymphocytes. Isopentenyl pyrophosphate, and related derivatives including (E)-hydroxy-dimethyl-allyl pyrophosphat...
T78336	Mouse IgG1 kappa, Isotype Control
	Mouse IgG1 kappa Isotype Control is a mouse monoclonal antibody that serves as an isotype control for mouse IgG1κ antibodies.
T82159	Human IgG1 (K214R) kappa, Isotype Control
	Human IgG1 (K214R) kappa Isotype Control is a chimeric monoclonal antibody that serves as an isotype control for the human IgG1 (K214R)κ antibody.
T28441	PPI-1019	PPI1019,Apan	Beta Amyloid
	PPI-1019 is an APP (β-amyloid A4) inhibitor for the treatment of neurological disorders and the study of Alzheimer's disease (AD).		Beta Amyloid
T7490	ARN2966		Beta Amyloid
	ARN2966 is an inhibitor of amyloid precursor protein (APP)and amyloid-β (Aβ) secretion.		Beta Amyloid

Compounds

Target: Gamma-secretase

δ-secretase inhibitor 11

T9713

Synonym:

Target: Beta Amyloid, Caspase

Pep-1 (uncapped)

TP1798

Synonym: Pep-1 uncapped

Target: Others

Human IgG4 (S228P) kappa, Isotype Control

Synonym: Dimethylallyl diphosphate triammonium,Dimethylallyl Pyrophosphate triammonium salt

Target: Others

Mouse IgG2a kappa, Isotype Control

Rat IgG1 kappa, Isotype Control

T78338

Synonym:

Target:

Rabbit IgG1 kappa, Isotype Control

T81317

Synonym:

Target:

Mouse IgG1 (D265A) kappa, Isotype Control

Human IgG1 (S239D/I332E) kappa, Isotype Control

T82158

Synonym:

Target:

Human IgG3 kappa, Isotype Control

T82156

Synonym:

Target:

3'-Deoxy-4-O-methylepisappanol

T126471

Synonym:

Target:

KQMEEEAVRLFIEWLKNGGPSSGAPPPS

Amylin (IAPP), feline TFA

T76028

Synonym:

Target:

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

T75860

Synonym:

Target:

Amylin (IAPP), feline

TP1519

Synonym:

Target:

Human IgG4 kappa, Isotype Control

T78244

Synonym:

Target:

Mouse IgG3 kappa, Isotype Control

T81756

Synonym:

Target:

Human IgG1 kappa, Isotype Control

T78242

Synonym:

Target:

Human IgG1 (N297A) kappa, Isotype Control

T78340

Synonym:

Target:

Mouse IgG2c kappa, Isotype Control

T81757

Synonym:

Target:

Human IgG1 (D265A) kappa, Isotype Control

T82161

Synonym:

Target:

Mouse IgG2b kappa, Isotype Control

Synonym: Lappaconitine hydrochloride

Target:

IgG light chain variable region [Homo sapiens]/IgM/kappa antibody [Mus musculus]

T22856

Synonym:

Target: Others

(SP-4-4)-2-[2-(Amino-KappaN)ethyl]phenyl-KappaC]chloro[dicyclohexyl[2',4',6'-tris(1-methylethyl)[1,1'-biphenyl]-2-yl]phosphine]-Palladium

T66146

Synonym:

Target:

Human IgG1 (D270N) kappa, Isotype Control

Human IgG2 kappa, Isotype Control

APPA

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Mouse IgG1 (N297A) kappa, Isotype Control

T81759

Synonym:

Target:

Mouse lgG2a (D265A) kappa, Isotype Control

T81755

Synonym:

Target:

Human IgG1 (F405L) kappa, Isotype Control

4-O-Methylepisappanol

(E)-C-HDMAPP (ammonium salt)

T38039

Synonym:

Target:

Mouse IgG1 kappa, Isotype Control

T78336

Synonym:

Target:

Human IgG1 (K214R) kappa, Isotype Control

Synonym: PPI1019,Apan

カタログ番号	製品名	別名	ターゲット
T13589	Caesappanin C		Others
	Caesappanin C, extracted from the heartwood of Indonesian Caesalpinia sappan L., shows strong proliferation stimulating activity against the primary osteoblastic cells in vitro.		Others
T2806	Lappaconitine	(+)-Lappaconitine	P2X Receptor , Sodium Channel
	Lappaconitine ((+)-Lappaconitine), isolated from Aconitum sinomontanum Nakai, was characterized as an analgesic.		P2X Receptor , Sodium Channel
TJS1779	Protosappanin A	PTA	NADPH-oxidase , IL Receptor , IκB/IKK , TNF , NF-κB , TLR , ROS , COX , HIV Protease , JAK , NO Synthase , STAT
	Protosappanin A (PTA) has anti-oxidative/nitrative activities on brain immune and neuroinflammation through regulation of CD14/TLR4-dependent IKK/IÎºB/NF-ÎºB inflammation signal pathway; it exerts anti-neuroinflammatory ...
T6560	Lappaconitine hydrobromide	Lappaconite HBr,Allapinine	Others
	Lappaconitine hydrobromide (Allapinine) is a kind of alkaloid extracted from Aconitum sinomontanum Nakai. It has anti-inflammatory effects.		Others
TMA1570	Sappanone A		NF-κB , Nrf2
	Sappanone A is a high isoflavanone that exhibits anti-inflammatory effects by modulating Nrf2.Sappanone A attenuates allergic airway inflammation in ovalbumin-induced asthma.		NF-κB , Nrf2
T32570	Lappaconine	20-ethyl-1,14,16-trimethoxyaconitane-4,6,8-triol,O(sup 1)-Methyllappaconidine	Others
	Lappaconine (20-ethyl-1,14,16-trimethoxyaconitane-4,6,8-triol) derivated from norditerpenoid alkaloids.		Others
T6S1780	Protosappanin B	Q-100961,FT-0689654	Apoptosis
	1. Protosappanin B (Q-100961) significantly increases cell viability, inhibits cell apoptosis and up-regulates the expression of growth-associated protein 43. 2. Protosappanin B induces the degradation of p53 protein, vi...		Apoptosis
TN5670	Protosappanin A dimethyl acetal
	Protosappanin A dimethyl acetal shows significant xanthine oxidase inhibitory activity in a concentration-dependent manner.
TN1072	Lappaol A		P-gp , JNK
	Lappaol A has antioxidant and antiaging properties, it may promote the C. elegans longevity and stress resistance through a JNK-1-DAF-16 cascade. Lappaol A also has potential chemosensitizing activity, it may be candidat...		P-gp , JNK
TN3063	4-O-Methylsappanol		Antifection
	4-O-Methylsappanol shows activity against this fungus against Beauveria bassiana.		Antifection
TN5673	10-O-Methylprotosappanin B
	10-O-Methylprotosappanin B is a natural product of Caesalpinia, Fabaceae. The catalog number is TN5673 and the CAS number is 111830-77-4. 10-O-Methylprotosappanin B can be used as a reference standard.
TMA2576	Episappanol		IL Receptor , TNF
	Episappanol has anti-inflammatory activity , it can significantly inhibit the secretion of the pro-inflammatory cytokines interleukin (IL-6) and tumor necrosis factor-alpha (TNF-α).		IL Receptor , TNF
TN2923	3'-Deoxy-4-O-methylsappanol		Tyrosinase
	3'-Deoxy-4-O-methylsappanol shows moderate cytotoxicities against cultured human melanoma HMV-II cells with the IC50 value of 872.0 uM ± 2.4.		Tyrosinase
TN6461	Isolappaol A
	Isolappaol A is a natural product for research related to life sciences. The catalog number is TN6461 and the CAS number is 131400-96-9.
TN1245	3-Deoxysappanchalcone		Others , Akt , mTOR
	3-Deoxysappanchalcone is an effective HO-1 inducer at the translational level.		Others , Akt , mTOR
TN2180	Sappanchalcone		IL Receptor , BCL , TNF
	Sappanchalcone shows xanthine oxidase inhibitory activity, is a xanthine oxidase inhibitor.		IL Receptor , BCL , TNF
TN6463	Lappaol B
	Lappaol B is a natural product for research related to life sciences. The catalog number is TN6463 and the CAS number is 62359-60-8.
TN1246	3-Deoxysappanone B		Others
	3-Deoxysappanone B has vasorelaxation effects, it can mediate endothelium- independent vasodilator action in rat thoracic aortic rings.		Others
TN4410	Lappaol C		P-gp , JNK
	Lappaol C has antioxidant and antiaging properties, it may promote the C. elegans longevity and stress resistance through a JNK-1-DAF-16 cascade. Lappaol C also has potential chemosensitizing activity, it may be candidat...		P-gp , JNK
T40454	DMAPP	Dimethylallyl diphosphate
	DMAPP, also known as Dimethylallyl pyrophosphate, is an isoprenoid precursor found in all life forms. It serves as an isomer of isopentenyl pyrophosphate (IPP).
TN6462	Isolappaol C
	Isolappaol C is a natural product for research related to life sciences. The catalog number is TN6462 and the CAS number is 929905-15-7.
T82338	Ganoapplanoid F
	Ganoapplanoid F, a highly oxygenated lanostane triterpenoid derived from Ganoderma applanatum, impedes lipid accumulation in adipocytes and offers potential for obesity research [1].
TN4411	Lappaol F		CDK , P-gp , JNK
	1. Lappaol F has antioxidant and antiaging properties, it may promote the C. elegans longevity and stress resistance through a JNK-1-DAF-16 cascade. <br/> 2. Lappaol F has potential chemosensitizing activity, it may be c...		CDK , P-gp , JNK
T14305	Apicidin	OSI 2040	Apoptosis , HDAC , Autophagy
	Apicidin (OSI 2040) is a histone deacetylase (HDAC) inhibitor with antiparasitic activity and antiproliferative activity.Apicidin attenuates memory deficits, inhibits cell growth and proliferation, and induces apoptosis ...		Apoptosis , HDAC , Autophagy
TN1420	Bacopaside I		Others
	Bacopaside I is a saponin isolated from Bacopa monniera. Bacopaside I is a modulator of Aquaporin-1 channel, has neuroprotective functions, it has anti-Alzheimer's disease, it ameliorates cognitive impairment in APP/PS1 ...		Others
T79994	7-Deoxy-trans-dihydronarciclasine
	7-Deoxy-trans-dihydronarciclasine is an alkaloid that functions as a tobacco mosaic virus (TMV) inhibitor with an IC50 of 1.80 μM and also serves as an anti-neuroinflammatory agent. This compound reduces Aβ and APP level...
TN4399	Kushenol C		SGLT , NF-κB , ROS , BACE , Antifection
	Kushenol C is a good 1,1-diphenyl-2-picrylhydrazyl (DPPH) scavenger, and it exhibits inhibitory activity against Sodium-dependent glucose cotransporter 2(SGLT2). Kushenol C shows antimicrobial activity against Staphyloco...		SGLT , NF-κB , ROS , BACE , Antifection

天然物製品

Synonym: (+)-Lappaconitine

Target: P2X Receptor, Sodium Channel

Protosappanin A

TJS1779

Synonym: PTA

Target: NADPH-oxidase, IL Receptor, IκB/IKK, TNF, NF-κB, TLR, ROS, COX, HIV Protease, JAK, NO Synthase, STAT

Lappaconitine hydrobromide

T6560

Synonym: Lappaconite HBr,Allapinine

Synonym: 20-ethyl-1,14,16-trimethoxyaconitane-4,6,8-triol,O(sup 1)-Methyllappaconidine

Target: Others

Protosappanin B

T6S1780

Synonym: Q-100961,FT-0689654

Target: Apoptosis

Protosappanin A dimethyl acetal

10-O-Methylprotosappanin B

Target: IL Receptor, TNF

3'-Deoxy-4-O-methylsappanol

3-Deoxysappanchalcone

TN1245

Synonym:

Target: Others, Akt, mTOR

Sappanchalcone

TN2180

Synonym:

Target: IL Receptor, BCL, TNF

Synonym: Dimethylallyl diphosphate

Target: CDK, P-gp, JNK

Apicidin

T14305

Synonym: OSI 2040

Target: Apoptosis, HDAC, Autophagy

7-Deoxy-trans-dihydronarciclasine

Target: SGLT, NF-κB, ROS, BACE, Antifection

Recombinant Proteins

Species：

Expression System：

Tag：

カタログ番号	製品名	Species	Expression System
TMPY-00752	BACE1 Protein, Human, Recombinant (His)	Human	HEK293 Cells
	BACE1 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 49.9 kDa and the accession number is A0A024R3D7.
TMPY-00678	BACE1 Protein, Mouse, Recombinant (His)	Mouse	HEK293 Cells
	BACE1 Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 49.8 kDa and the accession number is P56818.
TMPY-00668	APP/Protease nexin-II Protein, Human, Recombinant (hFc)	Human	HEK293 Cells
	APP/Protease nexin-II Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 101 kDa and the accession number is P05067-8.
TMPY-00652	BACE1 Protein, Human, Recombinant	Human	HEK293 Cells
	BACE1 Protein, Human, Recombinant is expressed in HEK293 mammalian cells. The predicted molecular weight is 49 kDa and the accession number is A0A024R3D7.
TMPY-00651	BACE1 Protein, Human, Recombinant (hFc)	Human	HEK293 Cells
	BACE1 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 75 kDa and the accession number is A0A024R3D7.
TMPH-01059	Cathepsin B Protein, Human, Recombinant (GST)	Human	E. coli
	Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Cleaves matrix extracellular phosphoglycoprotein MEPE. Involved in the solubilization of cross-linked TG/thyroglobuli...
TMPY-03065	BACE2 Protein, Mouse, Recombinant (His)	Mouse	HEK293 Cells
	BACE2, also known as beta secretase 2, belongs to the peptidase A1 family. It is a protease known to be an important enzyme involved in the cellular pathways. BACE2 has been shown to interact with GGA1 and GGA2. It is th...
TMPJ-00497	CTSB Protein, Human, Recombinant (His)	Human	HEK293 Cells
	Cathepsin B is an enzymatic protein belonging to the peptidase (or protease) families. The protein encoded by this gene is a lysosomal cysteine protease composed of a dimer of disulfide-linked heavy and light chains, bot...
TMPJ-00782	Amyloid Precursor Protein, Human, Recombinant (hFc)	Human	HEK293 Cells
	Amyloid precursor protein (APP) is a type I membrane protein with several isoforms due to alternative splicing, performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and...
TMPY-02120	XPNPEP2 Protein, Human, Recombinant (His)	Human	HEK293 Cells
	Aminopeptidase P (APP) is a hydrolase specific for N-terminal imido bonds, which are common to several collagen degradation products, neuropeptides, vasoactive peptides, and cytokines. A membrane-bound and soluble form o...
TMPJ-01350	XPNPEP3 Protein, Human, Recombinant (His)	Human	E. coli
	Probable Xaa-Pro Aminopeptidase 3 (XPNPEP3) is a member of the peptidase M24B family. XPNPEP3 has two isoforms and both are widely expressed. XPNPEP3 is localized in the Mitochondrion. XPNPEP3 catalyzes the release of an...
TMPY-03885	Beta-amyloid 38/Beta-APP38 Protein, Human, Recombinant (aa 672-709, His & GST)	Human	E. coli
	Beta-amyloid 38/Beta-APP38 Protein, Human, Recombinant (aa 672-709, His & GST) is expressed in E. coli expression system with His and GST tag. The predicted molecular weight is 32.1 kDa and the accession number is P05067...
TMPH-01563	IAPP Protein, Human, Recombinant (His)	Human	P. pastoris (Yeast)
	Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism.
TMPY-03884	Beta-amyloid 39/Beta-APP39 Protein, Human, Recombinant (aa 672-710, His & GST)	Human	E. coli
	Beta-amyloid 39/Beta-APP39 Protein, Human, Recombinant (aa 672-710, His & GST) is expressed in E. coli expression system with His and GST tag. The predicted molecular weight is 32.2 kDa and the accession number is P05067...
TMPH-01550	Interferon kappa/IFNK Protein, Human, Recombinant (His & SUMO)	Human	E. coli
	May play a role in the regulation of immune cell function. Cytokine that imparts cellular protection against viral infection in a species-specific manner. Activates the interferon-stimulated response element signaling pa...
TMPH-01562	IAPP Protein, Human, Recombinant (GST)	Human	E. coli
	Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism. IAPP Protein, Human, Recombinant (GST) is expressed in E. coli expression s...
TMPY-02221	Beta-amyloid 42/Beta-APP42 Protein, Human, Recombinant (His & GST)	Human	E. coli
	Beta-amyloid 42/Beta-APP42 Protein, Human, Recombinant (His & GST) is expressed in E. coli expression system with His and GST tag. The predicted molecular weight is 32.4 kDa and the accession number is P05067-1.
TMPJ-00748	Ig kappa Protein, Human, Recombinant (His)	Human	HEK293 Cells
	Immunoglobulin Kappa is constant region of immunoglobulin light chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humor...
TMPY-02110	Beta-amyloid 40/Beta-APP40 Protein, Human, Recombinant (His & GST)	Human	E. coli
	Beta-amyloid 40/Beta-APP40 Protein, Human, Recombinant (His & GST) is expressed in E. coli expression system with His and GST tag. The predicted molecular weight is 31.8 kDa and the accession number is P05067-1.
TMPY-06724	Mal d 1 Protein, Apple, Recombinant	Apple	P. pastoris (Yeast)
	Mal d 1 Protein, Apple, Recombinant is expressed in P. pastoris yeast expression system. The predicted molecular weight is 18.4 kDa.
TMPJ-00500	Kappa-Casein Protein, Human, Recombinant (His)	Human	HEK293 Cells
	Kappa-Casein (CSN3) is a secreted protein that belongs to the Kappa-Casein family. CSN3 exists in heteromultimers that are composed of alpha-s 1casein and kappa casein linked by disulfide bonds. CSN3 is involved in a nu...
TMPY-00894	PAPP-A2 Protein, Human, Recombinant (His)	Human	HEK293 Cells
	Pappalysin-2/PAPP-A2 is the second member of the pappalysin family of metzincin superfamily, of which PAPP-A is the first member. There is no homology between the prepro-peptides of PAPP-A and PAPP-A2, but 46% of the res...
TMPH-03261	Cathepsin D Protein, Rat, Recombinant (His & Myc)	Rat	E. coli
	Acid protease active in intracellular protein breakdown. Plays a role in APP processing following cleavage and activation by ADAM30 which leads to APP degradation. Cathepsin D Protein, Rat, Recombinant (His & Myc) is exp...
TMPH-00929	APBA2 Protein, Human, Recombinant (His & Myc)	Human	HEK293 Cells
	Putative function in synaptic vesicle exocytosis by binding to STXBP1, an essential component of the synaptic vesicle exocytotic machinery. May modulate processing of the amyloid-beta precursor protein (APP) and hence fo...
TMPJ-00358	DR6 Protein, Mouse, Recombinant (hFc & His)	Mouse	HEK293 Cells
	Tumor necrosis factor receptor superfamily member 21(DR6) is a single-pass type I membrane protein and contains 1 death domain and 4 TNFR-Cys repeats. The protein may activate NF-kappa-B and promote apoptosis and it may ...
TMPJ-00722	APBA3 Protein, Human, Recombinant (His)	Human	E. coli
	Amyloid β A4 Precursor Protein-Binding Family A Member 3 (APBA3) is an adapter protein that belongs to the X11 family. APBA3 contains 2 PDZ (DHR) domains and 1 PID domain and interacts with the Alzheimer's disease amyloi...
TMPH-01541	ITIH4 Protein, Human, Recombinant (His)	Human	P. pastoris (Yeast)
	Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.
TMPH-01542	ITIH4 Protein, Human, Recombinant (His & SUMO)	Human	E. coli
	Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.
TMPY-00473	NRBF2 Protein, Human, Recombinant (His & GST)	Human	Baculovirus Insect Cells
	NRBF2 (Nuclear Receptor Binding Factor 2) is a Protein Coding gene. The encoded protein may modulate transcriptional activation by target nuclear receptors. It is widely expressed in the appendix, placenta, and other tis...
TMPJ-00133	MBL2 Protein, Mouse, Recombinant	Mouse	HEK293 Cells
	Mannose-binding Lectin (MBL) is an acute phase protein bearing to the family of collectins produced by the liver as a monomer that forms a triple helix. Once released in serum, it further polymerizes forming dimers to oc...
TMPJ-00851	IDE Protein, Human, Recombinant (His)	Human	HEK293 Cells
	Insulin-Degrading Enzyme (IDE) is a secreted enzyme that belongs to the peptidase M16 family. IDE is a large zinc-binding protease and cleaves multiple short polypeptides that vary considerably in sequence. IDE plays a r...
TMPJ-01398	ITM2B Protein, Human, Recombinant (His)	Human	HEK293 Cells
	Integral Membrane Protein 2B (ITM2B) is expressed in the Golgi and on the cell surface. ITM2B forms homodimer through disulfide-linked interaction with SPPL2A, SPPL2B and APP. ITM2B is expressed in brain and the other ti...
TMPK-00507	TREM2 Protein, Cynomolgus, Recombinant (His)	Cynomolgus	HEK293 Cells
	TREM-2 (Triggering Receptor Expressed on Myeloid cells-2) is a 35 kDa type I transmembrane member of the TREM family and Ig superfamily. Mature human TREM-2 consists of a 156 amino acid (aa) extracellular domain (ECD) w...
TMPY-00519	Gastrokine 1 Protein, Human, Recombinant (His)	Human	Baculovirus Insect Cells
	Gastrokine 1 (GKN1) belongs to the BRICHOS domain family and plays a major role in maintaining gastric mucosa integrity. GKN1 is highly expressed in gastric tissue and is secreted into the stomach but is not expressed in...
TMPH-02539	MGAT3 Protein, Mouse, Recombinant (His & Myc)	Mouse	E. coli
	It is involved in the regulation of the biosynthesis and biological function of glycoprotein oligosaccharides. Catalyzes the addition of N-acetylglucosamine in beta 1-4 linkage to the beta-linked mannose of the trimannos...
TMPH-01502	Humanin Protein, Human, Recombinant (GST)	Human	E. coli
	Plays a role as a neuroprotective factor. Protects against neuronal cell death induced by multiple different familial Alzheimer disease genes and amyloid-beta proteins in Alzheimer disease. Mediates its neuroprotective e...
TMPH-01503	Humanin Protein, Human, Recombinant (hFc)	Human	HEK293 Cells
	Plays a role as a neuroprotective factor. Protects against neuronal cell death induced by multiple different familial Alzheimer disease genes and amyloid-beta proteins in Alzheimer disease. Mediates its neuroprotective e...
TMPH-01282	ELAVL4 Protein, Human, Recombinant (His & Myc & SUMO)	Human	E. coli
	RNA-binding protein that is involved in the post-transcriptional regulation of mRNAs. Plays a role in the regulation of mRNA stability, alternative splicing and translation. Binds to AU-rich element (ARE) sequences in th...

BACE1 Protein, Human, Recombinant (His)

TMPY-00752

Species: Human

Expression System: HEK293 Cells

BACE1 Protein, Mouse, Recombinant (His)

TMPY-00678

Species: Mouse

Expression System: HEK293 Cells

APP/Protease nexin-II Protein, Human, Recombinant (hFc)

TMPY-00668

Species: Human

Expression System: HEK293 Cells

BACE1 Protein, Human, Recombinant

TMPY-00652

Species: Human

Expression System: HEK293 Cells

BACE1 Protein, Human, Recombinant (hFc)

TMPY-00651

Species: Human

Expression System: HEK293 Cells

Cathepsin B Protein, Human, Recombinant (GST)

TMPH-01059

Species: Human

Expression System: E. coli

BACE2 Protein, Mouse, Recombinant (His)

TMPY-03065

Species: Mouse

Expression System: HEK293 Cells

CTSB Protein, Human, Recombinant (His)

TMPJ-00497

Species: Human

Expression System: HEK293 Cells

Amyloid Precursor Protein, Human, Recombinant (hFc)

TMPJ-00782

Species: Human

Expression System: HEK293 Cells

XPNPEP2 Protein, Human, Recombinant (His)

TMPY-02120

Species: Human

Expression System: HEK293 Cells

XPNPEP3 Protein, Human, Recombinant (His)

TMPJ-01350

Species: Human

Expression System: E. coli

Beta-amyloid 38/Beta-APP38 Protein, Human, Recombinant (aa 672-709, His & GST)

TMPY-03885

Species: Human

Expression System: E. coli

IAPP Protein, Human, Recombinant (His)

TMPH-01563

Species: Human

Expression System: P. pastoris (Yeast)

Beta-amyloid 39/Beta-APP39 Protein, Human, Recombinant (aa 672-710, His & GST)

TMPY-03884

Species: Human

Expression System: E. coli

Interferon kappa/IFNK Protein, Human, Recombinant (His & SUMO)

TMPH-01550

Species: Human

Expression System: E. coli

IAPP Protein, Human, Recombinant (GST)

TMPH-01562

Species: Human

Expression System: E. coli

Beta-amyloid 42/Beta-APP42 Protein, Human, Recombinant (His & GST)

TMPY-02221

Species: Human

Expression System: E. coli

Ig kappa Protein, Human, Recombinant (His)

TMPJ-00748

Species: Human

Expression System: HEK293 Cells

Beta-amyloid 40/Beta-APP40 Protein, Human, Recombinant (His & GST)

TMPY-02110

Species: Human

Expression System: E. coli

Mal d 1 Protein, Apple, Recombinant

TMPY-06724

Species: Apple

Expression System: P. pastoris (Yeast)

Kappa-Casein Protein, Human, Recombinant (His)

TMPJ-00500

Species: Human

Expression System: HEK293 Cells

PAPP-A2 Protein, Human, Recombinant (His)

TMPY-00894

Species: Human

Expression System: HEK293 Cells

Cathepsin D Protein, Rat, Recombinant (His & Myc)

TMPH-03261

Species: Rat

Expression System: E. coli

APBA2 Protein, Human, Recombinant (His & Myc)

TMPH-00929

Species: Human

Expression System: HEK293 Cells

DR6 Protein, Mouse, Recombinant (hFc & His)

TMPJ-00358

Species: Mouse

Expression System: HEK293 Cells

APBA3 Protein, Human, Recombinant (His)

TMPJ-00722

Species: Human

Expression System: E. coli

ITIH4 Protein, Human, Recombinant (His)

TMPH-01541

Species: Human

Expression System: P. pastoris (Yeast)

ITIH4 Protein, Human, Recombinant (His & SUMO)

TMPH-01542

Species: Human

Expression System: E. coli

NRBF2 Protein, Human, Recombinant (His & GST)

TMPY-00473

Species: Human

Expression System: Baculovirus Insect Cells

MBL2 Protein, Mouse, Recombinant

TMPJ-00133

Species: Mouse

Expression System: HEK293 Cells

IDE Protein, Human, Recombinant (His)

TMPJ-00851

Species: Human

Expression System: HEK293 Cells

ITM2B Protein, Human, Recombinant (His)

TMPJ-01398

Species: Human

Expression System: HEK293 Cells

TREM2 Protein, Cynomolgus, Recombinant (His)

TMPK-00507

Species: Cynomolgus

Expression System: HEK293 Cells

Gastrokine 1 Protein, Human, Recombinant (His)

TMPY-00519

Species: Human

Expression System: Baculovirus Insect Cells

MGAT3 Protein, Mouse, Recombinant (His & Myc)

TMPH-02539

Species: Mouse

Expression System: E. coli

Humanin Protein, Human, Recombinant (GST)

TMPH-01502

Species: Human

Expression System: E. coli

Humanin Protein, Human, Recombinant (hFc)

TMPH-01503

Species: Human

Expression System: HEK293 Cells

ELAVL4 Protein, Human, Recombinant (His & Myc & SUMO)

TMPH-01282

Species: Human

Expression System: E. coli

カタログ番号	製品名
L1000	Approved Drug Library	2808 compounds
	A unique collection of 2808 approved drugs for high throughput screening (HTS) and high content screening (HCS);
L2110	Anti-Cancer Approved Drug Library	1779 compounds
	A unique collection of 1779 approved anti-cancer drugs for high throughput screening (HTS) and high content screening (HCS);
L1020	EMA Approved Drug Library	657 compounds

L1010	FDA-Approved & Pharmacopeia Drug Library	3158 compounds
	3158 compounds from marketed drugs for high throughput screening (HTS) and high content screening (HCS);
L1610	FDA-Approved Kinase Inhibitor Library	263 compounds
	A unique collection of 263 kinase inhibitors/regulators for specific targeting of kinases, ready for high-throughput screening and high-content screening.
L4200	FDA-Approved Drug Library	1729 compounds
	A unique collection of 1729 FDA approved drugs for high throughput screening (HTS) and high content screening (HCS);