検索結果

Search Results for " tool "

ターゲット

307

阻害剤

天然化合物

リコンビナントタンパク質

ライブラリー

カタログ番号	製品名	別名	ターゲット
T23280	Ruthenium Red	Ammoniated ruthenium oxychloride	Calcium Channel
	Ruthenium Red (Ammoniated ruthenium oxychloride) is a polycationic dye widely used for electron microscopy (EM) of cells, tissues and vegetative bacteria. Ruthenium red strongly reacts with phospholipids and fatty acids ...		Calcium Channel
T4316	ML365		Potassium Channel
	ML365 is a novel selective small molecule inhibitor of TASK1(KCNK3).		Potassium Channel
T4314	EPZ020411	EPZ020411 2HCl	Histone Methyltransferase
	EPZ020411 is a specific and effective inhibitor of PRMT6 (IC50=10 nM).		Histone Methyltransferase
T0582	Fructooligosaccharides		Others
	Fructooligosaccharides is a levorotatory monosaccharide and an isomer of glucose.		Others
T5981	2,2'-Anhydrouridine	O2,2'-Cyclouridine,2,2'-Cyclouridine	Antiviral , Reverse Transcriptase
	2,2'-Anhydrouridine (2,2'-Cyclouridine) is a research tool for antiviral and anticancer studies.		Antiviral , Reverse Transcriptase
T21221	Meldrum's acid	Isopropylidene malonate,AI3-39039	Antibacterial
	Meldrum's acid (Isopropylidene malonate) is an antimicrobial agent used in deodorant. Meldrum's acid-based multicomponent reaction is a potential tool to prepare novel polymers.		Antibacterial
T67772	Phos-tag Acrylamide AAL-107
	Phos-tag Acrylamide AAL-107 is an acrylamide-pendant that can be used as a tool to visualize phosphorylated proteins.
T60020	5'-Fluoro-5'-deoxyadenosine	5'-Fluoro-5'-deoxy-adenosine	Others
	5'-Fluoro-5'-deoxyadenosine (5'-Fluoro-5'-deoxy-adenosine) is utilized commonly as a tool for studying the Actinomycete bacterium Streptomyces cattleya.		Others
T14994	Coelenterazine h	2-Deoxycoelenterazine,CLZN-h	Others
	Coelenterazine H is a synthetic derivative of coelenterazine (a light-emitting biomolecule).Coelenterazine h (CLZN-h) is more sensitive to Ca 2+ than is the native complex, thus providing a valuable tool for measuring sm...		Others
T40350	HPK1-IN-4	HPK1-IN-4	MAPK
	HPK1-IN-4 is an HPK1 (MAPK41) inhibitor with an IC 50 of 0.061 nM. HPK1-IN-4 is often used as a preclinical immunotherapy tool compound.		MAPK
T4057	Hoechst 33258 trihydrochloride	Hoechst 33258,Pibenzimol,Bisbenzimide,H 33258 trihydrochloride,bisBenzimide H 33258 trihydrochloride,HOE 33258	Parasite
	Hoechst 33258 trihydrochloride (Bisbenzimide) is a benzimidazole anti-filarial agent. it is fluorescent when it binds to certain nucleotides in DNA, thus providing a tool for the study of DNA replication. it also interfe...		Parasite
T63788	PCLX-001		Others
	PCLX-001 is a small-molecule compound that acts as an orally active inhibitor of N-myristoyltransferase (NMT), specifically targeting NMT1 and NMT2 with IC50 values of 5 nM and 8 nM, respectively. This compound demonstra...		Others
T39817	Msr-Ratio	Msr-green,Msr-Ratio	Others
	Msr-Ratio (Msr-green) (Msr-green) is a ratiometric fluorescent probe specifically designed for the detection of methionine sulfoxide reductase (MSR) activity. It has an excitation wavelength of 375 nm and an emission wav...		Others
T22180	3F8	3F 8,3F-8	GSK-3
	3F8 is a selective GSK-3β inhibitor that can be used as a new tool and potential therapeutic candidate compound for GSK3-related diseases, and can be used in the study of neurological disorders and cancer.		GSK-3
T60219	ELOVL1-IN-3		Others
	ELOVL1-IN-3 is a potent and orally active inhibitor of elongation of very long chain fatty acid 1 (ELOVL1) enzyme. ELOVL1-IN-3 serves as a useful tool for researching adrenoleukodystrophy (ALD).		Others
T77613	SNX7	WAY-323879	CDK
	SNX7 (WAY-323879) is an inhibitor of the cell cycle protein-dependent kinase inhibitor (CDKI) pathway. SNX7 can be utilized as a tool for investigating the aging process and other diseases associated with CDKI.		CDK
T6515	Go6976	Gö 6976	PKC
	Go6976 is a small molecule inhibitor of protein kinase C (PKC). Go6976 has been widely used in biomedical research as a tool to study the role of PKC in various physiological and pathophysiological processes.		PKC
T9314	CC214-1		mTOR , Autophagy
	CC214-1 is an mTOR inhibitor with potential anticancer activity, inhibits protein translation, and induces autophagy. CC214-1 is an in vitro tool compound for exploring the biology of mTOR kinases and can be used to stud...		mTOR , Autophagy
T78274	Omburtamab
	Omburtamab, an anti-CD276 (also known as B7-H3) monoclonal antibody, targets the B7/CD28 family protein CD276, prevalent in solid human tumors. This binding capability positions omburtamab as a potential research tool in...
TP1344	Luciferase		Others
	Luciferase is a flavin-dependent monooxygenase found in bioluminescent bacteria. Luciferase is an invaluable tool for identifying and characterizing functional variants, allowing investigations of gene expression, intrac...		Others
T21720	GP-82996	Cdk4/6 Inhibitor IV,CINK4	CDK
	GP-82996 (CINK4) is a pharmacological inhibitor specifically targeting CDK4/6, exhibiting IC50 values of 1.5 μM for CDK4/cyclin D1, 5.6 μM for CDK6/cyclin D1, and 25 μM for Cdk5/p35. It effectively induces apoptosis in U...		CDK
T67835	LKM38
	LKM38, a novel diazolidinyl cholesterol probe, is a promising cholesterol mimetic.LKM38 both maintains cholesterol-resistant cell growth and appropriately regulates key cholesterol homeostatic pathways.LKM38 can be a pow...
T11553	Heptamidine dimethanesulfonate	SBi4211 dimethanesulfonate	Others
	Heptamidine dimethanesulfonate (SBi4211 dimethanesulfonate) serves as a potent inhibitor related to Pentamidine, targeting the calcium-binding protein S100B with a dissociation constant (Kd) of 6.9 µM. It demonstrates sp...		Others
T64355	TDI-10229		cAMP
	TDI-10229 is a potent and orally available inhibitor of soluble adenylyl cyclase (sAC, ADCY10). TDI-10229 displays nanomolar inhibition of sAC in both biochemical and cellular assays (IC50= 195 nM). TDI-10229 exhibits mo...		cAMP
T74982	Akt3 degrader 1
	Akt3 Degrader 1 (compound 12l), a selective Akt3 degrader, effectively overcomes Osimertinib-induced resistance in H1975OR NSCLC cells. Besides its role in overcoming drug resistance, it exhibits anti-proliferative prope...
T9361	5-bromo-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione	5-bromo-2-(2,6-dioxopiperidin-3-yl)isoindoline-1,3-dione	Others
	5-bromo-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione (5-bromo-2-(2,6-dioxopiperidin-3-yl)isoindoline-1,3-dione) is a synthetic compound. It has been used as a catalyst and as a tool in enzyme kinetic studies; it has al...		Others
T13330	WAY-213613 hydrochloride	WAY-213613 hydrochloride (868359-05-1 free base)	transporter
	WAY-213613 hydrochloride is a potent, selective nonsubstrate reuptake inhibitor of GLT-1/EAAT2 with IC 50 of 85 nM. WAY-213613 hydrochloride inhibits EAAT1 and EAAT3 with IC50 values of 5 and 3.8 microM, respectively. WA...		transporter
T22891	KL001	KL 001,KL-001	Others
	KL 001 is a Cryptochrome protein (CRY) stabilizer. KL001 prevented ubiquitin-dependent degradation of CRY, resulting in lengthening of the circadian period. KL001-mediated CRY stabilization inhibited glucagon-induced glu...		Others
T37020	Endosidin-2	ES2,Endosidin 2
	Endosidin-2 is an exocyst inhibitor, a cell-permeable benzylidene benzoylhydrazine, that binds to the exocyst component of the 70 kDa (EXO70) subunit of the exocyst complex (Kd = 253 μM, EXO70A1).Endosidin-2 disrupts pro...
T36466	Chlorin E6	Ce6,Chlorin e6,CE6	Parasite
	Chlorin E6 (CE6) is a second-generation photosensitizer with antitumor activity when used in combination with irradiation. In a mouse model of implanted fibrosarcoma, Chlorin E6 (2.5-10 mg/kg, i.v., 50-200 J/cm2 irradiat...		Parasite
T33958	PH 1008	PH1008,PH-1008
	PH 1008 is a porphyrin photosensitizer that may be useful as a diagnostic tool.
T31156	Cysteine hydrazide	Cysteine,L-hydrazide
	Cysteine hydrazide is an enrichment tool for the mass spectrometric characterization of bacterial-free oligosaccharides.
T33688	Nitromifene Citrate	Parke davis CI-628,CI-628 citrate,CI 628 citrate,CI628 citrate
	Nitromifene Citrate is a nonsteroidal estrogen antagonist most commonly used as a research tool in animal studies.
T40957	Adeninobananin
	Adeninobananin, a negative control tool, exhibits no inhibitory activity against the SARS Coronavirus helicase.
T69922	EPZ020411 HCl
	EPZ020411 is a potent and selective PRMT6 inhibitor tool compound. EPZ020411 shows good bioavailability following subcutaneous dosing in rats making it a suitable tool for in vivo studies. EPZ020411 suppresses RCC1 argin...
T26343	YK5	YK 5,YK-5
	YK5 is an allosteric inhibitor pocket of Hsp70 and represents a previously unknown chemical tool to investigate cellular mechanisms associated with Hsp70.
T37695	NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
	NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ, an ACE2-related peptide, serves as a valuable research tool for comprehending ACE2 functions.
T82920	Barzuxetan	CHX-A''-DTPA-NCS
	Barzuxetan is a potential research tool in oncology [1].
T38938	Antibacterial agent 37
	Antibacterial agent 37 is an effective antimicrobial compound. It holds potential as a valuable tool for researching bacterial infections.
T17965	Fmoc-NH-PEG11-CH2CH2COOH		Others
	Fmoc-NH-PEG11-CH2CH2COOH, a PEG-based PROTAC linker, serves as a valuable tool in PROTAC synthesis[1].		Others
T40648	NOTA
	NOTA, a bifunctional chelate, serves as a foundation for PET imaging tool construction, probe design, and signal amplification through the multivalent effect.
T61868	Antitumor agent-66
	Antitumor agent-66 (Compound 4) is a derivative of (-)-cleistenolide, showcasing potential as a research tool for cancer diseases [1].
T39140	SCO-267
	SCO-267 is a potent allosteric full agonist of the GPR40 receptor, making it a valuable tool in studying chronic diseases like diabetes.
T36669	IYPTNGYTR acetate
	IYPTNGYTR acetate, a deamidation-sensitive peptide derived from Trastuzumab, is a suitable tool for monitoring the metabolism of Trastuzumab in vivo [1].
T17762	DBCO-NHCO-PEG13-NHS ester		Others
	DBCO-NHCO-PEG13-NHS ester is a pegylated PROteolysis-TArgeting Chimera (PROTAC) linker, serving as a valuable tool for PROTAC synthesis[1].		Others
T30216	AV-105	AV105,AV 105
	Av-105 is the precursor of florbetapir (18F). It is a radiopharmaceutical compound scanned by pet, which can be used as a diagnostic tool for Alzheimer's disease.
T39729	HIV Protease Substrate 1
	HIV Protease Substrate 1 is a fluorogenic compound that offers insights into the enzymatic activity of HIV protease, making it a valuable tool for studying this aspect.
T74091	PBFI-AM
	PBFI-AM is a useful tool to determine intracellular K + content [1] .
T61423	Transthyretin-IN-1
	Transthyretin-IN-1 (Compound 1d) is a potent inhibitor of transthyretin (TTR) fibril formation, making it a valuable tool for investigating Alzheimer’s disease [1].
T38955	β-Lactamase-IN-4
	β-Lactamase-IN-4 (WO2013149121A1, compound 708) is a potent β-lactamase inhibitor. It serves as a valuable tool in the investigation of bacterial infections.

Compounds

Ruthenium Red

T23280

Synonym: Ammoniated ruthenium oxychloride

Target: Calcium Channel

ML365

T4316

Synonym:

Target: Potassium Channel

EPZ020411

T4314

Synonym: EPZ020411 2HCl

Target: Histone Methyltransferase

Fructooligosaccharides

Synonym: O2,2'-Cyclouridine,2,2'-Cyclouridine

Target: Antiviral, Reverse Transcriptase

Meldrum's acid

T21221

Synonym: Isopropylidene malonate,AI3-39039

Target: Antibacterial

Phos-tag Acrylamide AAL-107

T67772

Synonym:

Target:

5'-Fluoro-5'-deoxyadenosine

T60020

Synonym: 5'-Fluoro-5'-deoxy-adenosine

Target: Others

Coelenterazine h

T14994

Synonym: 2-Deoxycoelenterazine,CLZN-h

Hoechst 33258 trihydrochloride

T4057

Synonym: Hoechst 33258,Pibenzimol,Bisbenzimide,H 33258 trihydrochloride,bisBenzimide H 33258 trihydrochloride,HOE 33258

Synonym: Msr-green,Msr-Ratio

Target: mTOR, Autophagy

Synonym: Cdk4/6 Inhibitor IV,CINK4

Heptamidine dimethanesulfonate

T11553

Synonym: SBi4211 dimethanesulfonate

5-bromo-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione

T9361

Synonym: 5-bromo-2-(2,6-dioxopiperidin-3-yl)isoindoline-1,3-dione

Target: Others

WAY-213613 hydrochloride

T13330

Synonym: WAY-213613 hydrochloride (868359-05-1 free base)

Target: transporter

KL001

T22891

Synonym: KL 001,KL-001

Target: Others

Endosidin-2

T37020

Synonym: ES2,Endosidin 2

Target:

Chlorin E6

T36466

Synonym: Ce6,Chlorin e6,CE6

Target: Parasite

PH 1008

T33958

Synonym: PH1008,PH-1008

Target:

Cysteine hydrazide

T31156

Synonym: Cysteine,L-hydrazide

Target:

Nitromifene Citrate

T33688

Synonym: Parke davis CI-628,CI-628 citrate,CI 628 citrate,CI628 citrate

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ

Synonym: CHX-A''-DTPA-NCS

Target:

Antibacterial agent 37

T38938

Synonym:

Target:

Fmoc-NH-PEG11-CH2CH2COOH

DBCO-NHCO-PEG13-NHS ester

Synonym: AV105,AV 105

Target:

HIV Protease Substrate 1

カタログ番号	製品名	別名	ターゲット
T3S1251	Neoruscogenin		ROR
	1. Neoruscogenin represents a universal pharmacological tool for RORα research due to its specific selectivity profile versus other nuclear receptors.		ROR
T10662L	Calcimycin	Antibiotic A-23187,A-23187	Apoptosis , Antibacterial , Antibiotic , Autophagy , Antifungal

T7285	Ionomycin		Calcium Channel
	Ionomycin is an calcium ionophore and an antibiotic that binds calcium ions (Ca2+). It is produced by the bacterium Streptomyces conglobatus.It is used in research to raise the intracellular calcium level (Ca2+) and as ...		Calcium Channel
T0414	D-Mannitol	Mannite,Mannitol,Osmitrol	Apoptosis , Dehydrogenase , Endogenous Metabolite
	D-Mannitol (Mannitol) is a diuretic and renal diagnostic aid related to sorbitol. It has little significant energy value as it is largely eliminated from the body before any metabolism can take place. It can be used to t...		Apoptosis , Dehydrogenase , Endogenous Metabolite
T0791	Reserpine	Serpalan,Serpasil,Serpivite	Others , Potassium Channel , MRP , Monoamine Transporter , Autophagy
	Reserpine (Serpalan) is an alkaloid found in the roots of Rauwolfia serpentina and R. vomitoria. Reserpine inhibits the uptake of norepinephrine into storage vesicles resulting in depletion of catecholamines and serotoni...
T40381	2,8-Dihydroxyadenine
	2,8-Dihydroxyadenine, an endogenous metabolite, can induce the generation of urinary crystals and nephrolithiasis. Moreover, 2,8-Dihydroxyadenine serves as a diagnostic tool for detecting adenine phosphoribosyltransferas...
T6627	Phosphoramidon Disodium	Phosphoramidon Disodium Salt	RAAS , Neprilysin , Others
	Phosphoramidon Disodium (Phosphoramidon Disodium Salt) Salt is a metalloendopeptidase inhibitor, widely used as a biochemical tool.		RAAS , Neprilysin , Others
T39277	D-Hexamannuronic acid
	D-Hexamannuronic acid, an alginate oligomer, is derived from marine brown algae and a restricted group of Gram negative bacteria. This compound serves as a valuable tool for investigating pain and vascular dementia[4].
T40966	D-Heptamannuronic acid
	D-Heptamannuronic acid, an alginate oligomer, is derived from marine brown algae and a select group of Gram-negative bacteria. This compound serves as a valuable research tool in the study of pain and vascular dementia[4...
T41025	Prunetin 5-O-β-D-glucopyranoside
	Prunetin 5-O-β-D-glucopyranoside, an isoflavone obtained from Potentilla astracanica extracts, is a potent uncompetitive inhibitor of α-glucosidase (IC 50 = 56.05 μg/mL). It serves as a valuable tool for type-2 diabetes ...
T78505	Ethyl pivaloylacetate
	Ethyl pivaloylacetate, a β-ketoester, serves as a substrate for assessing the activity and stereoselectivity of the ketoreductase tool-box [1].
T38954	L-Glyceric acid sodium
	L-Glyceric acid sodium is a urinary metabolite predominantly found in individuals with the rare inherited metabolic disorder, L-glyceric aciduria. This compound serves as a diagnostic tool for identifying primary hyperox...
TN3057	4-O-Methylbutein		Autophagy
	4-O-Methylbutein (2',3,4'-trihydroxy-4-methoxychalcone) may have anti-inflammation activity, it is a potent heme oxygenase-1 (HO-1) inducer, the upregulation of HO-1 has proven to be a useful tool for fighting inflammati...		Autophagy
T73068	Mammea A/BA
	Mammea A/BA demonstrates significant efficacy in inhibiting Trypanosoma cruzi (T. cruzi), through mechanisms such as mitochondrial dysfunction, increased production of reactive oxygen species (ROS), and DNA fragmentation...

天然物製品

Synonym: Antibiotic A-23187,A-23187

Target: Apoptosis, Antibacterial, Antibiotic, Autophagy, Antifungal

Ionomycin

T7285

Synonym:

Target: Calcium Channel

D-Mannitol

T0414

Synonym: Mannite,Mannitol,Osmitrol

Target: Apoptosis, Dehydrogenase, Endogenous Metabolite

Reserpine

T0791

Synonym: Serpalan,Serpasil,Serpivite

Target: Others, Potassium Channel, MRP, Monoamine Transporter, Autophagy

Phosphoramidon Disodium

T6627

Synonym: Phosphoramidon Disodium Salt

Target: RAAS, Neprilysin, Others

D-Hexamannuronic acid

T39277

Synonym:

Target:

D-Heptamannuronic acid

T40966

Synonym:

Target:

Prunetin 5-O-β-D-glucopyranoside

T41025

Synonym:

Target:

Ethyl pivaloylacetate

T78505

Synonym:

Target:

L-Glyceric acid sodium

Recombinant Proteins

Species：

Expression System：

Tag：

カタログ番号	製品名	Species	Expression System
TMPY-01280	FOLR2 Protein, Human, Recombinant (His)	Human	HEK293 Cells
	Folate receptor beta, also known as Folate receptor 2, FBP, and FOLR2, is a member of the folate receptor family. FOLR2 is expressed in placenta and hematopoietic cells. The expression of FOLR2 is increased in malignant ...
TMPY-03391	ESD Protein, Human, Recombinant (His)	Human	E. coli
	Esterase D, also known as ESD, is a serine hydrolase that belongs to the esterase D family. Esterase D is active toward numerous substrates including O-acetylated sialic acids, and it may be involved in the recycling of ...
TMPY-00184	Xg blood group Protein, Human, Recombinant (His)	Human	HEK293 Cells
	XG, Gene ID 7499, stands for Xg glycoprotein or Xg blood group. The XG blood group system includes 2 antigens: Xga and CD99 (encoded by the MIC2 gene). The XG blood group is the first blood group mapped to the human X ch...
TMPY-04626	Enterokinase/EK Protein, Bovine, Recombinant	Bovine	P. pastoris (Yeast)
	Enterokinase is a member of the trypsin family of serine proteases. The precursor protein is cleaved into two chains which then forms a heterodimer linked by a disulfide bond. The heavy chain anchors enterokinase in the ...
TMPY-03985	Adenosine Deaminase Protein, Human, Recombinant (His)	Human	Baculovirus Insect Cells
	Adenosine Desaminase (ADA) deficiency, is a purine metabolic disorder that cause severe combined immunodeficiency (SCID) due to the accumulation of toxic metabolites that primarily affects development, differentiation a...
TMPY-01416	OLFM4 Protein, Human, Recombinant (His)	Human	HEK293 Cells
	Olfactomedin-4, also known as G-CSF-stimulated clone 1 protein, Antiapoptotic protein GW112, and OLFM4, is a secreted protein that contains one olfactomedin-like domain. The OLFM4 gene was recently reported to inhibit va...

FOLR2 Protein, Human, Recombinant (His)

TMPY-01280

Species: Human

Expression System: HEK293 Cells

ESD Protein, Human, Recombinant (His)

TMPY-03391

Species: Human

Expression System: E. coli

Xg blood group Protein, Human, Recombinant (His)

TMPY-00184

Species: Human

Expression System: HEK293 Cells

Enterokinase/EK Protein, Bovine, Recombinant

TMPY-04626

Species: Bovine

Expression System: P. pastoris (Yeast)

Adenosine Deaminase Protein, Human, Recombinant (His)

TMPY-03985

Species: Human

Expression System: Baculovirus Insect Cells

OLFM4 Protein, Human, Recombinant (His)

TMPY-01416

Species: Human

Expression System: HEK293 Cells

カタログ番号	製品名
L2700	Adrenergic Receptor-Targeted Compound Library	193 compounds
	A unique collection of 193 bioactive compounds specifically targeting adrenergic receptors, effective tool for screening new drugs or new target identification;
L4520	Anti-Bacterial Compound Library	904 compounds
	A unique collection of 904 antibacterial bioactive compounds, a powerful tool for antibacterial drug development;
L6160	RO5 Drug-like Natural Product Library	2703 compounds
	A unique collection of 2703 natural product monomers that meet the "Lipinski's Rule of Five", a powerful tool for HTS and HCS screening;
L2900	Oxidation-Reduction Compound Library	1264 compounds
	1264 small molecule compounds with pro-oxidant or anti-oxidant activity for high-throughput and high-content screening.
L4200	FDA-Approved Drug Library	1729 compounds
	A unique collection of 1729 FDA approved drugs for high throughput screening (HTS) and high content screening (HCS);
L1900	Anti-Diabetic Compound Library	683 compounds
	A unique collection of 683 diabetes related compounds;
L3100	Hematopoietic Toxicity Compound Library	101 compounds
	A unique collection of 101 compounds with defined hematopoietic toxicity for high throughput and high content drug screening;
L4510	Anti-Parasitic Compound Library	419 compounds
	419 well-chosen unique anti-parasitic small molecules;
L6730	Anti-virus Traditional Chinese Medicine Monomer Library	268 compounds
	A collection of 268 TCM monomers with anti-virus activity. An effective tool for drug development and pharmacological studies.
L3400	Clinical Compound Library	3404 compounds
	A unique collection of 3404 compounds in clinical trial phases for high throughput screening (HTS) and high content screening (HCS);
L8800	Drug-Fragment Library	1119 compounds
	1119 drug fragments，a must-have tool for FBDD;
L4660	Anti-Nervous System Disease Library	1246 compounds
	Well-chosen 1246 compounds with unique structures targeting nervous system;
L1380	Transcription Factor-Targeted Compound Library	695 compounds
	Well-chosen 695 compounds with unique structures targeting transcription factor;
L2910	Antioxidant Compound Library	1314 compounds
	Oxidative stress reflects an imbalance between the systemic manifestation of reactive oxygen species (ROS) and a biological system's ability to readily detoxify the reactive intermediates or repair the resulting damage. ...
L2000	Inhibitor Library	8328 compounds
	A unique collection of 8328 inhibitors for research in cell signaling, high throughput screening (HTS) and high content screening (HCS) for new drugs;
L2151	Chemotherapy Drug Library	48 compounds
	48 Chemotherapeutic drugs that can be used for high-throughput and high-content screening.
L6100	Polyphenolic Natural Product Library	635 compounds
	A unique collection of 635 natural polyphenolic compounds for high throughput screening (HTS) and high content screening (HCS);
L6710	Anti-Inflammatory Traditional Chinese Medicine Compound Library	1246 compounds
	A collection of 1246 TCM monomers with anti-inflammatory activity or targeting molecular therapeutic targets in inflammation, a powerful tool for drug discovery and mechanism study；
L2152	Targeted Therapy Drug Library	119 compounds
	119 tumor-targeted drugs that can be used for high-throughput and high-content screening.
L1700	Anti-Viral Compound Library	1040 compounds
	A unique collection of 1040 anti-virus compounds effective for new anti-virus drugs high throughput screening and high content screening;
L3200	Autophagy Compound Library	1248 compounds
	A unique collection of 1248 compounds with defined autophagy-inducing or -inhibitory activity for research in autophagy, high throughput screening (HTS) and high content screening (HCS) for new drugs;
L9810	Anti-Fibrosis Compound Library	1180 compounds
	A unique collection of 1180 potential anti-fibrosis compounds, can be used in HTS and HCS;
L5510	Drug-induced Liver Injury (DILI) Compound Library	1001 compounds
	A unique collection of 1001 hepatotoxicity causing compounds, a powerful tool for drug toxicity study, can be used for HTS and HCS screening；
L6300	Food as Medicine Compound Library	1290 compounds
	A unique collection of 1290 compounds from food as medicine for high throughput and high content screening;
L4500	Anti-Fungal Compound Library	252 compounds
	A unique collection of 252 antifungal compounds effective for drug repurposing screening, combination screening and biological investigation.
L9200	Drug Repurposing Compound Library	4630 compounds
	A unique collection of 4630 approved and clinical drugs for high throughput screening (HTS) and high content screening (HCS);
L6900	Rare Natural Product Library	693 compounds
	A unique collection of 693 rare natural products, which can be used for high throughput screening (HTS) and high content screening (HCS);
L6600	Anti-Gastroenteritis Natural Product Library	219 compounds
	A unique collection of 219 natural products related to gastroenteritis for high throughput screening (HTS) and high content screening (HCS);
L8200	Anti-Aging Compound Library	3279 compounds
	A unique collection of 3279 anti-aging compounds for high throughput screening (HTS) and high content screening (HCS);
L6810	Traditional Chinese Medicine Monomer Library	2755 compounds
	A unique collection of 2755 compounds (TCM monomers) sourcing from traditional Chinese Medicines, is a powerful tool for drug discovery and research in mechanism；
L8110	Reprogramming Compound Library	1813 compounds
	A unique collection of 1813 reprogramming signaling pathway-related bioactive small molecule compounds for high-throughput, high-content screening.
L2195	Anti-Prostate Cancer Compound Library	2070 compounds
	2070 compounds associated with prostate cancer that can be used for high-throughput and high-content screening.
L6800	Chinese Pharmacopoeia Natural Product Library	2051 compounds
	A unique collection of 2051 natural products included in Chinese Pharmacopoeia (CP), a powerful tool for drug development and pharmacological study;
L2180	Anti-Cancer Compound Library Plus	1468 compounds
	Well-chosen 1468 anti-tumor compounds with unique structures;
L2193	Anti-Liver Cancer Compound Library	1787 compounds
	1787 species of compounds related to liver cancer that can be used in anti-liver cancer drug development and pharmacological studies.
L7200	Calcium Channel Compound Library	140 compounds
	A unique collection of 140 calcium channel blockers and agonists for high throughput and high content screening;
L6700	Anti-Tumor Natural Product Library	1772 compounds
	A unique collection of 1772 natural products with known anti-cancer activity for high throughput screening (HTS) and high content screening (HCS);
L2191	Anti-Breast Cancer Compound Library	1939 compounds
	A unique collection of 1939 compounds with anti-breast cancer therapeutic activity or targeting breast cancer’s major signaling pathways, can be used for anti-breast cancer drug discovery and mechanism study；
L7400	Sodium Channel Blocker Library	118 compounds
	A unique collection of 118 sodium channel blockers and agonists for high throughput and high content screening;
L9900	Inactive Ingredient Library	182 compounds

L5700	Featured Fragment Library	246 compounds
	A unique collection of 246 fragment-like small molecules for FBDD;
L2520	Glycometabolism Compound Library	702 compounds
	702 glycometabolism-related comounds, can be used for HTS and HCT;
L2510	Lipid Metabolism Compound Library	492 compounds
	A unique collection of 492 compounds targeting lipid metabolism, can be used for high-throughput screening (HTS) and high-content screening (HCS).
L9500	Target-Focused Phenotypic Screening Library	1796 compounds
	A unique collection of 1796 annotated bioactive compounds with clear targets, suitable for phenotypic screening；
L9700	Endoplasmic Reticulum Stress Compound Library	193 compounds
	A unique collection of 193 endoplasmic reticulum stress (ER stress) related compounds used for high throughput screening (HTS) and high content screening (HCS);
L5100	Fluorochemical Library	574 compounds
	A unique collection of 574 fluorochemicals that can be used for high through-put screening (HTS) and high content screening (HCS);
L6740	Anti-Colorectal Cancer Traditional Chinese Medicine Compound Library	382 compounds
	A collection of 382 TCM monomers with anti-colorectal activity. An effective tool for drug development and pharmacological studies.
L6000	Natural Product Library for HTS	4533 compounds
	A unique collection of 4533 pure natural products and their derivatives with known biological activity for drug discovery, pharmacological study, stem cell differentiation, fingerprint study and quality research, and can...
L9230	ReFRAME Related Library	3210 compounds
	A unique collection of 3210 compounds for high-throughput screening and high-content screening,
L6610	Anti-infective Natural Product Library	1060 compounds
	A unique collection of 1060 species of natural products with anti-infective activity for high throughput screening (HTS) and high content screening (HCS);
L6020	Selectable Natural Product Library	16627 compounds
	A unique collection of 16627 pure natural products with diverse structures and sources covering various plant, animal, and microbe species;
L2010	Highly Selective Inhibitor Library	575 compounds

L2194	Anti-Colorectal Cancer Compound Library	1545 compounds
	1545 compounds associated with colorectal cancer that can be used for high-throughput and high-content screening.
L2550	Glutamine Metabolism Compound Library	565 compounds
	A unique collection of 565 glutamine metabolism related compounds can be used for high throughput screening (HTS) and high content screening (HCS), and also is an effective tool for research in glutamine metabolism and ...
L4020	NO PAINS Compound Library	9384 compounds

L2170	Immuno-Oncology Compound Library	449 compounds
	A unique collection of 449 compounds acting on immune-oncology therapeutic targets can be used for high throughput and high content screening；
L2560	Metabolism Compound Library	2320 compounds

L1610	FDA-Approved Kinase Inhibitor Library	263 compounds
	A unique collection of 263 kinase inhibitors/regulators for specific targeting of kinases, ready for high-throughput screening and high-content screening.
L6200	The Yao nationality medicine Library	221 compounds
	A collection of 221 natural product molecules originated from Yao medicine, which can be used for high-throughput and high-content screening.
L8700	Ferroptosis Compound Library	779 compounds
	A unique collection of 779 ferroptosis signaling pathway related compounds, a powerful tool for new target identification, drug discovery, and mechanism study；
L6620	Antiparasitic Natural Product Library	253 compounds
	A unique collection of 253 natural products with antiparasitic activity, a powerful tool for high throughput screening (HTS) and high content screening (HCS);
L2196	Anti-Ovarian Cancer Compound Library	1867 compounds

L6820	Tobacco Monomer Library	747 compounds

L6720	Anti-COVID-19 Traditional Chinese Medicine Compound Library	1147 compounds
	A unique collection of 1147 monomers from 60 TCM plants, a powerful tool for anti-COVID-19 drug discovery, can be used for HTS and HCS screening；